KEGG   Chlorella variabilis: CHLNCDRAFT_10119Help
Entry
CHLNCDRAFT_10119  CDS       T02924                                 

Definition
hypothetical protein
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
cvr  Chlorella variabilis
Brite
Enzymes [BR:cvr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     CHLNCDRAFT_10119
Peptidases [BR:cvr01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   CHLNCDRAFT_10119
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 333 aa AA seqDB search
WTTIESDPGVFTELLDRMGVKGVQMEELWSLDDDSLNSLQPIYGLIFLFKWQKEEDERPV
ATDYEERGVFFASQVIHNACATQARRCPCSRRSFRSPAIVSVLMNRPELEIGPELSQLRE
FTRGFPPDMKGLAIGNSETIRSVHNSFSPPQPILPPEERDDDKGEAFHFIAYVPVGGCLY
ELDGLKEGPIKLADCSEGDWLTKAAAAITARIRRYAASEVKFNLMACIEDRRQKHQRELA
QQRRLQVRLRGPHSAATQRSWDGAAGLAGQAGMPARSLACPRLQAQLAMEEERRGRWRDE
NVRRRTDYIPFAFQLLSALAERGQLQPLVQKAQ
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
tggacgacgatagagagcgacccgggagttttcaccgagctcctggaccggatgggcgtc
aaaggcgtgcagatggaggaactgtggtctctggacgatgacagcctcaacagcctgcag
cccatctacggcctcatcttcctattcaagtggcagaaggaggaggacgagcggcccgtg
gcgacagactatgaggagcggggcgtgttcttcgcctcccaagtcattcacaacgcctgc
gccacccaggcgcgccgctgcccctgctcccgccgctcctttcgcagccctgccattgtg
agcgtgctgatgaaccggcctgagctggagattgggccggagctgagccagctgcgggag
ttcactcggggcttcccgccagacatgaagggcctggccatcggcaacagcgagaccatt
cgctcggtgcacaactccttctccccgccgcagcccatcctgccgcccgaggagcgggac
gacgacaagggggaggccttccacttcattgcctacgtgcccgtgggcggctgcctgtac
gagctggatgggctgaaggaggggcccatcaagctggcagactgcagcgagggcgactgg
ctgaccaaggcggccgccgccatcaccgctcgcatcaggcgttacgcggccagcgaggtc
aagttcaacctgatggcgtgcatagaggaccggcggcagaagcaccagcgggagctggcc
cagcagcggcgcctgcaggtgcggctgcggggtccgcacagcgcagccacacagcgcagc
tgggatggggctgctgggctggcgggccaggcaggcatgcccgctcgctcgctcgcttgc
ccgcggctgcaggcccagctggcgatggaggaggagcggcgggggcggtggcgggacgag
aatgtgcggcggcgcacagactatatcccttttgccttccagctgctgtcggcgctggcg
gagcgcggccagctgcagccgctggtgcagaaggcgcag

DBGET integrated database retrieval system