KEGG   Chlorella variabilis: CHLNCDRAFT_134683Help
Entry
CHLNCDRAFT_134683 CDS       T02924                                 

Definition
hypothetical protein
Orthology
K01177  
beta-amylase [EC:3.2.1.2]
Organism
cvr  Chlorella variabilis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cvr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CHLNCDRAFT_134683
Enzymes [BR:cvr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.2  beta-amylase
     CHLNCDRAFT_134683
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 375 aa AA seqDB search
MSFHAAGNNVGDCCRISLPRWVVEAGERDPDIFFTDSSGYRNRECLSVGCDTQPVLLGRT
PIQAQADFIAAFADEFGDMLGNVISEVTVGMGPAGELRYPSYPEGDGRWRFPGIGQFQCY
DKYMLASLKEAAIAAGHPEWGHGGPHDSGNYNSHSSETGFFRSYGGSWDTEYGRFFLSWY
SGLLIQHADRLLGAARQVLSARCRPRAMREARELSDGGMLYVFGPAVQLGIKLAGVHWWF
KSRAHAAELTAGYYNTRERNGYLPIFDMLKRHSAAASFTCVEMRDCEHPIEGRCSPEGLL
NQVLSTAARVGVPMSGENALQRYDQYAFDKICDSAFGQSVMAGRLEKLTFLRMGDMMIDN
WSAFGAFLQRLTCPP
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgagcttccacgcagccggcaacaacgttggcgactgctgccggatcagcctgccgcgg
tgggtggtggaggccggggagcgcgaccctgacatcttcttcaccgactcctctggctac
cgcaaccgcgagtgcctgtccgtgggctgcgacacgcagccggtgctgctcgggcgcacg
cccatccaggcacaggccgactttatcgccgcctttgcggatgaatttggcgacatgctg
ggcaatgtgatcagcgaggtgacggtggggatgggccccgccggcgagctgcgctaccct
tcgtatccagagggcgacggccgctggcgcttccccggcatcggccagttccagtgctat
gacaagtacatgctggccagcctgaaggaagcggcaatagctgcggggcacccggagtgg
ggccacggcgggccacacgattcaggcaattacaacagccatagctccgagaccggcttc
ttccgcagctatggcggcagctgggacacagagtacggccgcttcttcctctcctggtac
tctggcctgctcatccagcacgccgaccggctgctgggcgctgcgcggcaagtgctgtcg
gcgcggtgccgaccgcgggcgatgcgggaggcgcgcgagctatcagatggcggcatgctc
tacgtgtttgggcccgcggtgcagctgggcatcaagttggcgggcgtgcactggtggttc
aagagccgcgcacatgccgcggagctgactgctgggtactacaacacgcgggagcgcaac
ggctaccttcccatctttgacatgctcaagcggcacagcgcggcagccagcttcacatgc
gtggagatgcgcgactgcgagcaccccatcgaggggcgctgctcgccagagggcctgctc
aaccaggtgctcagcaccgctgcgcgcgtgggggtgcccatgagcggcgagaatgcgctg
cagcggtatgaccagtatgcgtttgacaagatctgcgactctgcctttggccagagtgtg
atggctggccgcttagagaagctcacctttttgcgaatgggcgacatgatgattgacaac
tggagcgcctttggcgccttcctgcagcggctcacctgcccaccctga

DBGET integrated database retrieval system