KEGG   Chlorella variabilis: CHLNCDRAFT_140074Help
Entry
CHLNCDRAFT_140074 CDS       T02924                                 

Definition
hypothetical protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
cvr  Chlorella variabilis
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:cvr00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CHLNCDRAFT_140074
Enzymes [BR:cvr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     CHLNCDRAFT_140074
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 304 aa AA seqDB search
MAAHIAVAGSVNADFVYQLLRVPRAGETLPAKSMAVHPGGKGGNQAAAAARLGCPTQLVA
QVGRDAQAQMLRGALEGCGVDTSLVREVEGPTGTAVILLEEDGQNRIILHGGANTAPWQL
GEEARAAISSAGAVLLQREIPEAVNAELAHAAGVPVVLDAGGATAPLSPDLLRCLAVISP
NETELQGLTGMPTDTEEQIVAAAQVLRGQGVGTVLVKLGSRGSLLVDADGSTWRQEARRV
EKVVDTTGAGDCFTAAFAVAVLEGRPYREAMRFASVAAALCIQVAGAMPSMPSRQQVDAE
LAAA
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggcagcccacatcgcggtggcgggcagcgtgaatgccgactttgtgtatcagctgctg
cgggtgccgcgtgctggggagaccctgcctgcgaagagcatggcggtgcacccgggaggc
aagggcggcaaccaggcggccgcggcggcacgcctgggctgccccacccagctagtggca
caggttggccgcgatgcgcaggcacagatgctgcgcggagcgctggaggggtgcggcgtg
gacactagtctggtgcgggaggtggagggccccaccggtaccgccgtcatccttctggag
gaggatggccagaaccgcatcatactccacggcggcgccaacaccgcgccgtggcagctg
ggcgaggaggcgcgcgccgctatctcgtccgcaggtgcggtgctgctgcagcgggagatc
ccagaagccgtcaacgccgagctggcgcatgcggcgggcgttcccgtggtgctcgatgcc
ggcggcgcaaccgcccccctcagtcccgacctgctgcgctgcctggccgtcatctccccg
aacgagaccgagctgcaagggctgacaggcatgcccaccgacacagaggagcagatagtg
gcggcggcgcaggtgctgcgagggcagggcgtgggcaccgtgctggtaaagctgggctcc
cgcggaagcctgctcgtagatgcggatggcagcacgtggcggcaggaggcgcggcgggtg
gagaaggtggttgacacgacgggagcgggcgactgcttcaccgcagcctttgctgtggcg
gtactggagggcaggccgtaccgtgaggcaatgcgctttgccagcgtggcagctgccctg
tgcatccaggtggcgggcgccatgcccagcatgcccagcaggcagcaggtggacgctgag
ctggcggcagcctag

DBGET integrated database retrieval system