KEGG   Chlorella variabilis: CHLNCDRAFT_19794Help
Entry
CHLNCDRAFT_19794  CDS       T02924                                 

Definition
hypothetical protein
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
cvr  Chlorella variabilis
Brite
Enzymes [BR:cvr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     CHLNCDRAFT_19794
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 293 aa AA seqDB search
KEHQEKTKVKNIQSVELGRHEVDTWYYSPYPEPHASCNKLYLCEYTLKYFRKKKTLLRHL
AKCTLRHPPGDEIYRSPPPPSNDPMFEVDGKKSKVYCQNLCLLSKLFLDHKTLYYDVDPF
LFYVLCEKDALGYHIVGYFSKEKNSAEGNNLACILTLPPYQRKGYGRFLIAFSYELSKKE
GRVGSPERPLSDLGAVSYRSYWTREILEVLKDHKASLSIKDISDKTAIRTDDVVKTLESL
SLIKYWKGDHIISVTHKIVEEHLKTIANQKNIEIDLNRLHWTPYRNEPPNAKK
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
aaggagcaccaggagaagaccaaggtgaagaacatccagagcgtggagctgggcaggcac
gaggtggacacctggtactactcaccctaccctgagccccacgcctcctgcaacaagctg
tacctgtgcgagtacacgctcaagtacttccgcaagaagaagacgctgctgcggcacctg
gccaagtgcacgctgcggcacccgcctggggatgagatctaccgctcgccgccgccgcca
tccaacgaccccatgtttgaggtggacggcaagaagagcaaggtgtactgccagaacctg
tgcctgctgtccaagctgttcctcgaccacaagaccctctactacgacgtcgaccccttc
ctgttctacgtgctctgcgagaaggacgccctgggctaccacatcgtgggctacttctcc
aaggagaagaacagcgccgagggcaacaacctggcctgcatcctcaccctgccgccctac
cagcgcaagggctacggccgcttcctcatcgccttctcgtacgagctgagcaagaaggag
gggcgggtggggtcgcccgagcgcccgctgtccgacctgggcgcggtatcgtaccgcagc
tactggacgcgcgagatcctcgaggtgcttaaggaccacaaggccagcctgtccattaag
gacatctcggacaagaccgccatacgcacggacgacgtggtgaagacgctggagagcctg
agcctgatcaagtactggaagggggaccacatcatcagcgtgacgcacaagattgtggag
gagcacctcaagaccatcgccaaccagaagaacattgagatcgacctcaaccgcctgcac
tggacgccctaccgcaacgagccgcccaacgccaagaagtag

DBGET integrated database retrieval system