KEGG   Chlorella variabilis: CHLNCDRAFT_29368Help
Entry
CHLNCDRAFT_29368  CDS       T02924                                 

Definition
hypothetical protein
Orthology
K01602  
ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
cvr  Chlorella variabilis
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Photorespiration
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:cvr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CHLNCDRAFT_29368
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CHLNCDRAFT_29368
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    CHLNCDRAFT_29368
Enzymes [BR:cvr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     CHLNCDRAFT_29368
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 184 aa AA seqDB search
MASTVAAIAPVAVRPMASTPLKQAKNTFAARTVSNGSIKKVSAMQVWTPLNNKMFETFSF
LPPLTDGEISRQVDYIVRNGWTPCLEFADADHAYVDDTSTIRLRGNAVPLYYDNRYWCMW
KLPMFGCTDGQQVLREIQNCRRAFPDAYIRLVGFDSVRQVQVAGLLVNRPASVRDYQSPS
TRSV
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccaccgtcgctgccatcgcccctgtggccgtgcggcccatggccagcaccccc
ctgaagcaggccaagaacaccttcgcggcccgcaccgtgagcaacggctccatcaagaag
gtgtccgccatgcaggtgtggactcccctgaacaacaagatgttcgagaccttctccttc
ctgcctcccctcaccgacggcgagatctcccgccaggtcgactacatcgtgcgcaacggt
tggaccccttgcctggagttcgctgacgccgaccacgcgtacgtggacgacacctccacc
attcgcctgcgcggcaacgctgtgcccctgtactacgacaaccgttactggtgcatgtgg
aagctgcccatgttcggctgcactgacggccagcaggtgctgcgtgagatccagaactgc
cgccgcgccttccccgatgcctacatccgcctggtgggcttcgacagtgtccgccaggtg
caggtggccggcctgctggtgaaccgccctgcctcggtgcgcgactaccagagcccctcc
acccgctccgtttaa

DBGET integrated database retrieval system