KEGG   Chlorella variabilis: CHLNCDRAFT_30901Help
Entry
CHLNCDRAFT_30901  CDS       T02924                                 

Definition
(RefSeq) hypothetical protein
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
cvr  Chlorella variabilis
Pathway
cvr00500  Starch and sucrose metabolism
cvr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cvr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CHLNCDRAFT_30901
Enzymes [BR:cvr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     CHLNCDRAFT_30901
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase DUF5122
Motif
Other DBs
NCBI-GeneID: 17355753
NCBI-ProteinID: XP_005848371
JGI: ChlNC64A_1_30901
UniProt: E1ZCM6
Position
Unknown
AA seq 563 aa AA seqDB search
MGLLQRPPPTLALLLLAALLAAALAQPVHAFSNVPWQKQAVYQLLTDRFAAPQAMPGSRG
QQCGSLSNYCGGTWRGMLQQLRYIQGLNLNAIWSSPIAVQPYGGYHGYWPTDLYDVNPSF
GTPGDLQHVLQQLADQGMKHILDVVMNHVGYGSSVFLPAFNPFSDPSNFHNCTLAGCDPD
CNIPADNPTYDQQWHCQLSGLPDLNQSIPYVREMFADYIQWILSQYSVHMLRLDAAGSID
PDFFPYFMNFTTLPAWLEVGGKLQLHEQYEKVRGNASYSYQSWVIYNAASACFALSPTSD
EGDEGCLQISQSRSTLMSYGVEMGGVGYWVENHDTDRFLSTRASLPAYRNALAFILLAEG
IPIIYYGAEQGMTGLTIDNTNRWPLWEVGYDNTNPLYTHIRTLAWYRWWMNLGNKSFTEH
YMDRRTYTFSRGSDMVVVLTNGNYSEAVPRPAAYNLSGLASFAGDTLCDALRSGYCVEVS
EEGVALVQPSPTDEPLLLVHNNWVHSDTFFIMLHNRPVLWQQGLIVTFSTLCGALLLWFA
VGYGIQYYRTGSIHPAQDLSASC
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgggtctgctgcagcgcccgccaccgaccctggcgctgctgctcctggcggcgcttctg
gccgcggcgctggcgcagccggtgcatgcgttcagcaatgtgccttggcagaaacaagca
gtctaccagttgctgacagacaggttcgctgcgccacaggcaatgccaggcagccgcggc
cagcagtgcggcagcctgagcaactactgcggcggcacgtggaggggcatgctgcagcag
ctgcgctacatacagggcctcaacctgaacgccatctggagctcccccatcgcggtgcag
ccctatggcggctaccacggctactggcccaccgacctgtacgatgtgaacccctccttt
ggcacccccggcgacctgcagcacgtgctgcagcagctggcggaccaggggatgaagcac
attctggatgtggtgatgaaccacgtgggctacggctcctccgtcttcctccccgcattc
aaccccttctcagacccatccaatttccacaactgcacgctggcgggctgcgaccccgac
tgcaacatcccggctgacaaccccacctacgaccagcagtggcactgccagctcagcggc
ctgcccgacctcaaccagtcgattccgtatgtgcgggagatgtttgccgactacatccag
tggatactgtcgcagtacagcgtgcacatgctgcgtctggacgccgccggcagcatcgac
cccgacttcttcccgtacttcatgaactttacgaccctccccgcctggctggaagtgggc
ggcaaactacagctgcacgagcagtacgaaaaagtgcgcggcaacgcctcctacagctac
cagtcctgggtcatctacaacgccgccagcgcctgcttcgcgctctccccgacctcggat
gagggggatgaggggtgcctgcagatctctcagtcccgctccacactgatgagctacggc
gtggagatggggggggtggggtactgggtggagaaccacgacaccgaccgcttcctgtcc
acccgcgccagcctgcccgcctaccgcaacgctctggcgttcatattgctggcagagggc
atacccatcatctactatggcgcggagcagggcatgactgggttaacaatcgacaacacc
aatcgctggccgctgtgggaggtggggtacgacaacaccaacccgctgtacacgcacatc
cgcaccctggcgtggtaccgctggtggatgaacctgggcaacaagtcgttcacagagcac
tacatggaccgccgcacctacaccttctcgcgtggcagcgacatggtggtggtgctgacc
aacggcaactactcggaggcggtgccccgccctgccgcctacaacctgtcgggcctggcc
agctttgcaggggacacgctgtgcgacgcgctgcgcagcgggtactgcgtggaggtgtcg
gaggaaggtgtggcgctggtgcagccctcccccactgacgagcccctgctgctggtgcac
aacaactgggtccactccgacactttcttcatcatgctgcacaaccggccggtgctgtgg
cagcagggcctgatcgtcaccttcagcaccctctgcggcgccctgctgctctggtttgcc
gtggggtacggcatacagtactaccgcacaggcagcatccatccggcccaggacctctcc
gcctcctgc

DBGET integrated database retrieval system