KEGG   Chlorella variabilis: CHLNCDRAFT_34160Help
Entry
CHLNCDRAFT_34160  CDS       T02924                                 

Definition
(RefSeq) hypothetical protein
Organism
cvr  Chlorella variabilis
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 422 aa AA seqDB search
MVATALPPQMTSVSGRGLGLALGAKPVAGGLVRAPRLHAATSQRCARRISCQAARDNTRT
SAAAVEATLTMAPEDGSAVGEIMVPEWAGMSYDAQYDDIFSKPLNLRKVTPKPDPSAQAQ
VPGARKVPFSDVYGKPRKRLFWDRQFTTKDKVYLGYMAFVHVGALLAPFYFSWAHVAEFA
LMYFITGCLGITLSYHRQLTHRSFTTPKWLERVFAYCGVMSVQGDPLEWVSCHRYHHLHC
ETPLDPHSVYEGFWWSHMGWLLDDDATQSRVFDTSNAADIAKDPFYAHLHKHYTWHVVGM
FVAIYLLGGWGSLLWAGCLRTVWVYHITWFVNSAAHVWGTQTYETGDQSRNNWWVGLLGF
GEGWHNNHHAFEFSARHGLEDSQWDMTWQVIRFLDFLGLADNIKLPSEKQKERLRLEDTV
VV
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggttgccaccgctctgcccccccagatgacctccgtgtctggccgtgggctcggcctg
gccctcggcgcaaagcctgtggccggcggcctggtgcgggcccccaggctgcatgcagcc
acctcccagcgctgcgcccgccggatcagctgccaggcggctcgggacaacaccaggacc
agcgccgccgccgtggaggccaccctgaccatggctcctgaggacggctccgccgtgggc
gagatcatggtgccggagtgggcagggatgagctacgatgcacaatacgacgacatcttc
tccaagcccctcaacctgcgcaaggtcacccccaagcccgacccctccgcgcaggcgcag
gtgcccggagcgcgcaaggtccccttcagcgacgtctacggcaagccgcgcaagaggctg
ttctgggaccgacagtttaccaccaaggacaaggtgtacctcggctacatggcgtttgtg
cacgtgggcgccctgctggcgcccttctacttctcctgggcccacgtggccgagtttgcg
ctcatgtacttcatcaccggctgcctgggcatcacgctgtcctaccaccgccagctcacc
caccgctccttcaccacccccaagtggctggagcgcgtgtttgcctactgcggagtcatg
tcggtgcagggagacccgcttgagtgggtgtcgtgccaccgctaccaccacctgcactgc
gagacgccgctcgacccccactctgtgtacgagggcttctggtggagccacatgggctgg
ctgctggacgacgacgccacgcagagccgcgtgtttgacacctccaacgcagcggacatc
gccaaggaccccttctacgcgcacctgcacaagcactacacgtggcacgtggtgggcatg
tttgtggccatctacctgctgggaggctggggcagcctgctgtgggcgggctgcctgcgc
accgtctgggtctaccacatcacctggtttgtcaactccgcggcccacgtgtggggcacc
cagacgtatgagacgggcgaccagtctcgcaacaactggtgggtgggcctgctgggcttt
ggcgagggctggcacaacaaccaccacgcctttgagttctcggcgcggcacgggctggag
gactctcagtgggacatgacctggcaggtcattcggttcctggacttcctgggcctggca
gacaacatcaagctgcccagcgagaagcagaaggagcggctgcgcctggaggacaccgtc
gtcgtctga

DBGET integrated database retrieval system