KEGG   Chlorella variabilis: CHLNCDRAFT_34160Help
Entry
CHLNCDRAFT_34160  CDS       T02924                                 

Definition
hypothetical protein
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
cvr  Chlorella variabilis
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:cvr01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:cvr01040]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 422 aa AA seqDB search
MVATALPPQMTSVSGRGLGLALGAKPVAGGLVRAPRLHAATSQRCARRISCQAARDNTRT
SAAAVEATLTMAPEDGSAVGEIMVPEWAGMSYDAQYDDIFSKPLNLRKVTPKPDPSAQAQ
VPGARKVPFSDVYGKPRKRLFWDRQFTTKDKVYLGYMAFVHVGALLAPFYFSWAHVAEFA
LMYFITGCLGITLSYHRQLTHRSFTTPKWLERVFAYCGVMSVQGDPLEWVSCHRYHHLHC
ETPLDPHSVYEGFWWSHMGWLLDDDATQSRVFDTSNAADIAKDPFYAHLHKHYTWHVVGM
FVAIYLLGGWGSLLWAGCLRTVWVYHITWFVNSAAHVWGTQTYETGDQSRNNWWVGLLGF
GEGWHNNHHAFEFSARHGLEDSQWDMTWQVIRFLDFLGLADNIKLPSEKQKERLRLEDTV
VV
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggttgccaccgctctgcccccccagatgacctccgtgtctggccgtgggctcggcctg
gccctcggcgcaaagcctgtggccggcggcctggtgcgggcccccaggctgcatgcagcc
acctcccagcgctgcgcccgccggatcagctgccaggcggctcgggacaacaccaggacc
agcgccgccgccgtggaggccaccctgaccatggctcctgaggacggctccgccgtgggc
gagatcatggtgccggagtgggcagggatgagctacgatgcacaatacgacgacatcttc
tccaagcccctcaacctgcgcaaggtcacccccaagcccgacccctccgcgcaggcgcag
gtgcccggagcgcgcaaggtccccttcagcgacgtctacggcaagccgcgcaagaggctg
ttctgggaccgacagtttaccaccaaggacaaggtgtacctcggctacatggcgtttgtg
cacgtgggcgccctgctggcgcccttctacttctcctgggcccacgtggccgagtttgcg
ctcatgtacttcatcaccggctgcctgggcatcacgctgtcctaccaccgccagctcacc
caccgctccttcaccacccccaagtggctggagcgcgtgtttgcctactgcggagtcatg
tcggtgcagggagacccgcttgagtgggtgtcgtgccaccgctaccaccacctgcactgc
gagacgccgctcgacccccactctgtgtacgagggcttctggtggagccacatgggctgg
ctgctggacgacgacgccacgcagagccgcgtgtttgacacctccaacgcagcggacatc
gccaaggaccccttctacgcgcacctgcacaagcactacacgtggcacgtggtgggcatg
tttgtggccatctacctgctgggaggctggggcagcctgctgtgggcgggctgcctgcgc
accgtctgggtctaccacatcacctggtttgtcaactccgcggcccacgtgtggggcacc
cagacgtatgagacgggcgaccagtctcgcaacaactggtgggtgggcctgctgggcttt
ggcgagggctggcacaacaaccaccacgcctttgagttctcggcgcggcacgggctggag
gactctcagtgggacatgacctggcaggtcattcggttcctggacttcctgggcctggca
gacaacatcaagctgcccagcgagaagcagaaggagcggctgcgcctggaggacaccgtc
gtcgtctga

DBGET integrated database retrieval system