KEGG   Chlorella variabilis: CHLNCDRAFT_35292Help
Entry
CHLNCDRAFT_35292  CDS       T02924                                 

Definition
(RefSeq) hypothetical protein
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
cvr  Chlorella variabilis
Pathway
cvr00250  Alanine, aspartate and glutamate metabolism
cvr00410  beta-Alanine metabolism
cvr00430  Taurine and hypotaurine metabolism
cvr00650  Butanoate metabolism
cvr01100  Metabolic pathways
cvr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cvr00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    CHLNCDRAFT_35292
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CHLNCDRAFT_35292
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CHLNCDRAFT_35292
   00430 Taurine and hypotaurine metabolism
    CHLNCDRAFT_35292
Enzymes [BR:cvr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     CHLNCDRAFT_35292
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-GeneID: 17355344
NCBI-ProteinID: XP_005847936
JGI: ChlNC64A_1_35292
UniProt: E1ZE99
Position
Unknown
AA seq 546 aa AA seqDB search
MSSFLKTAAKALEQELQGLRSHPSHSDSTASLGAATKAERIPMLTPDMADPDKNVDDLLD
STFASRYTSTPLSKTAFPIHGVPAHVAYQLIKDIRKLDATPALNLASFVTTWMEPEAEKL
IHDSLNVNYVDTDEYPSSTEIHNRCVTMLAKLWHSPSVPDVGPVDAVGTACIGSSEAIML
GALSLKKKWQEAREKAGKDISKPNLVMGAQVHVCWQKFCRYFDVEERYVPVAEGRYVSTP
ELMRPLIDENTIGIASVFGSTYNGEFEDVEAIDALCTELNEKNGWGLAIHIDGASGAFVA
PFIYPELKWDFRLPNVTSINASGHKYGLVYPGLGWVIWRDPKHLPESMVFYENYLGTLER
SITLNFSKPATNIIAQYYQFLRLGYAGYRKIMTNLDIIRKRLINAINKTGHFEVLSKEVG
VPVVAFRLKKVLGSDGKEHRRLYDEFALADRLRMRGWVLPAYTMPDDAGHVKLMRVTIRE
DFSIGMADMLVKDIEDALEYLDNHFTFNKEEMDSLANLALGRRLSRLDTSILAAAADISK
QSVRPC
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtccttcctgaagacggccgcaaaggctcttgagcaggagctgcaaggcctcagg
agccacccttctcacagcgactccacggcaagcctgggcgccgccacgaaggcggagcgc
atccccatgctcacgcccgacatggccgaccccgacaagaatgtggatgacctgctggac
tccacctttgcctcacgctacacatccaccccgctcagcaagactgcgttccccatccac
ggcgtccccgcccacgtggcctaccagctgatcaaggacatccgcaagctggacgccacc
cccgccctcaacctggcctccttcgttaccacctggatggagccggaggctgagaagctg
attcatgacagtctcaacgtcaactacgtcgacacggacgagtaccccagcagcacggag
atccacaacaggtgtgtgacgatgctggccaagctgtggcactccccctcggtgccggat
gtgggccccgtggatgcagtgggcaccgcctgcatcggcagctccgaggcaatcatgctg
ggagccctgagcctgaagaagaagtggcaggaggcgcgggagaaggcgggcaaggacatc
agcaagcccaacctggtcatgggcgcgcaggtgcacgtgtgctggcagaagttctgccgc
tactttgatgtcgaggagcggtacgtgccggtggctgagggccgctatgtgtccacaccc
gagctcatgcgcccgctcatcgacgagaacaccatcggcattgcgtcggtgtttggcagc
acctacaatggcgagtttgaggatgtggaggccattgacgcgctgtgcacggagctgaac
gagaagaacggctgggggctggccatccacattgatggcgcctcgggcgcctttgtggcg
cccttcatctacccggagctcaagtgggacttccgcctgcccaacgtcacctccatcaac
gcctcgggccacaagtacggcctcgtgtacccaggcctgggctgggtcatctggcgcgac
cccaagcacctgcccgagagcatggtgttctacgaaaattatctcggaactttggagcgc
tcgatcacgctcaacttctccaagcccgccaccaatatcatcgcgcagtactaccagttc
ctgcgcctgggctatgccgggtaccgcaagatcatgaccaacctggacatcatccgcaag
cgcctcatcaacgccatcaacaagacgggccactttgaggtgctgtccaaggaggtgggg
gtgcctgtggtggccttccgcctcaagaaggtactgggctcggacggcaaggagcatcgc
cggctgtacgacgagtttgcgctggcagaccgcctgcgcatgcgtggctgggtgctgccg
gcctacactatgcccgacgacgccggccacgtcaagctgatgcgcgtgaccatcagggag
gacttctcaatcggcatggcagacatgttggtgaaggacattgaggatgcactggaatac
ctggacaaccacttcaccttcaacaaggaggagatggacagcctggccaatttggccctc
ggccgccgcctgtcccggctggacaccagcatcctggccgccgccgccgacatctccaag
cagtcggtgcgcccctgctga

DBGET integrated database retrieval system