KEGG   Chlorella variabilis: CHLNCDRAFT_50463Help
Entry
CHLNCDRAFT_50463  CDS       T02924                                 

Definition
hypothetical protein
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
cvr  Chlorella variabilis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cvr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CHLNCDRAFT_50463
Enzymes [BR:cvr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     CHLNCDRAFT_50463
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 425 aa AA seqDB search
MPQSTACFQPTQAALAPRPAQAPRLRLNASFGWQSWEGDRWWRTMRGQVPELAALGITHI
WLPPPSASVSTQGYLPGQLYMLNSRYGTGAELRALCADLLKAGVRPVADIVINHRCADAQ
DESGTWNIYRDMVPHPGKSIAWGRWAIAGSDRQFGGQGSPDSGEDYGPAPDLDHTNPEVR
DSLVDWLNYLRLSVGFEGWRFDFVKASSGEYVERTVGPDAFCVGELFLDLKWSNSFLEYG
QEAARGQFQDWLRAARHCCLFDFLTKGQLQEAAKHHEYDRLRDGQGRAPGLLGARPEHSV
TFVDNHDTGSSQQHWPFPRGFLGLGYAYILTHPGMPCIFHEHLQDSGLRQAITELVALRK
RAGIRSDSKLEILCAERDIYVARCNGNVVLKLGPRFDMGGLVPKAAEGWRLVQSGNDYAV
WEKAA
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgccgcagtcaaccgcgtgcttccaaccaacccaggccgctctggcgcccagaccggcc
caggcgcctcggctgcggctgaatgcaagcttcggctggcagtcgtgggagggcgaccgc
tggtggcgcacgatgcgcggccaggtgcccgagctggctgccctgggcatcacgcacatc
tggctgccgccgccctccgcctcggtctccacgcaaggctacctgccaggacagctctac
atgctcaacagccgctacggcacgggcgccgagctgcgggcgctgtgcgccgacctgctc
aaggcgggcgtcaggcctgtggccgacatagtgatcaaccaccgctgcgccgacgcccag
gacgagtctggcacctggaacatctacagggacatggtgccgcacccgggcaagagcatc
gcgtggggccgctgggccatcgcaggcagcgacaggcagttcggagggcagggatcgccg
gacagcggcgaggattacggccccgcaccggatctggaccacaccaaccccgaggtgcgc
gacagcctggtggactggctcaactacctgcgcctgtcagtgggcttcgagggctggcgc
ttcgactttgtcaaggcgagctcgggcgagtatgtggagcgcacggtggggcccgacgcc
ttctgcgtgggcgagctgttcctggacctcaagtggagcaactccttcctggagtacggc
caggaggcggcccgcgggcagttccaggactggctgcgcgccgcgcggcactgctgcctc
tttgacttcctcaccaagggccagctgcaggaggcggccaagcaccacgagtacgaccgg
ctgcgggacgggcaggggcgcgcccccggcctgctgggcgcccgccccgagcactccgtc
acctttgtggacaaccacgacaccggcagcagccagcagcactggcccttcccgcgtggc
ttcctgggactggggtatgcctacatactcacgcacccgggcatgccctgcatcttccac
gagcacctgcaggacagcgggctgcgacaggcaatcacagagctggtggcgctgcgcaag
cgggcgggcatccggtctgactccaagctggagatcctgtgcgccgagcgcgacatctat
gtggcgcgctgcaatggcaacgtggtgctgaagctgggcccgcgcttcgatatgggcggg
ctggtgcccaaggcggccgaggggtggcgcctggtgcagtcggggaacgactatgctgtt
tgggagaaggccgcctga

DBGET integrated database retrieval system