KEGG   Chlorella variabilis: CHLNCDRAFT_55490Help
Entry
CHLNCDRAFT_55490  CDS       T02924                                 

Definition
hypothetical protein
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
cvr  Chlorella variabilis
Brite
Enzymes [BR:cvr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     CHLNCDRAFT_55490
Transcription machinery [BR:cvr03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     CHLNCDRAFT_55490
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 375 aa AA seqDB search
MNREARHMEREHTGELQAVYITNNGSIENGRLLIGLKNVFSKCLPNMPKEYICRLIFERR
HKSVVIVRNGSQVIGGITYRTFPGTPAARLGEIAFCAVAQTLQVTGCGTRLMNWTKHYAR
EMDGLEYFLTYADNNAVGYFSKQSFTKTVTQEKDKWFGFIKDYDGGTLMECRIHPTLPYA
SFPEMLAKQRAALEGEVKRYTTGHVVHPGLPHWKEGGGPMPVGDIPGVVEAGWSHAAGML
YKEYQIAMNGQILDPTEDNLFEFMTMLLKKAQKHADAGPFQRPVSAMDVPDYYSIIIDPM
DLGTMEERLNSRRYYITLNMFAADFYKMVKNCQLYNGATNPYFLAAKRIYEVFWSVMRSS
ILPNLEAAGIVEPKL
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgcgaggcgcggcacatggagcgggagcacaccggcgagctgcaggccgtgtac
attacaaacaatggctccatagagaatggcagactgctgattggcttgaagaacgtgttc
agcaagtgcctacccaacatgcccaaggaatacatatgccgcctcatctttgagcgccgc
cacaagtctgtggtgatcgtgagaaacggcagccaagtcattggcggcatcacctaccgc
acttttccgggcacacccgccgccaggctgggcgaaattgcgttctgtgcagtggcgcag
acgctgcaggtcacaggctgcggcacgcggctcatgaactggaccaagcactatgcacgg
gagatggatgggttggagtactttctgacctatgccgataacaacgctgtgggctacttc
tccaagcagtccttcaccaagacggtgacacaagagaaggataagtggtttgggttcatc
aaggattatgacggtggcacgctcatggagtgccgcatccacccgacgctgccctacgcc
tccttcccagagatgttggcgaagcagcgggcggcgctggagggcgaggtcaagcgctac
actaccgggcatgtggtgcacccggggctgccgcactggaaggagggtggtgggccgatg
ccggttggggacatcccaggtgtggtggaggcggggtggagccatgcggcaggcatgctg
tacaaggagtatcagattgccatgaacggccagattttggaccctaccgaggacaacctg
tttgagttcatgaccatgctgctgaagaaggcgcagaagcatgccgatgcgggccccttt
cagcgccccgtatcggccatggacgtgcccgattactactccatcatcattgaccccatg
gacttgggcaccatggaggagcggctgaattcgagacgctattacatcacgctcaacatg
tttgccgccgacttctacaaaatggtcaagaactgccagctgtacaatggcgccacaaac
ccttacttcctggccgccaagcgcatatatgaggtcttctggtcggtcatgcgcagcagc
atcctgcccaacctggaggccgcaggcatcgtggagcccaagctgtag

DBGET integrated database retrieval system