KEGG   Chlorella variabilis: CHLNCDRAFT_9497Help
Entry
CHLNCDRAFT_9497   CDS       T02924                                 

Definition
hypothetical protein
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
cvr  Chlorella variabilis
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:cvr00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    CHLNCDRAFT_9497
Enzymes [BR:cvr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     CHLNCDRAFT_9497
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     CHLNCDRAFT_9497
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 150 aa AA seqDB search
QVRFLDRPEGVPPISELGWDPLLDMPSLPSFAAQLGGQRRAIKAVLLDQSFSAGIGNWVA
DEVLYQARIHPEQPAHSVPQEQVAALHRAISHVCQVACEVEADSSRFPPDWLFHHRWGNS
TPAKVGGRSIDHLTVGGRTSAFVPSLQKLD
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
caggttcgcttcctggatcggcccgagggcgtgccgcccatcagcgagctgggctgggac
ccgctgctcgacatgccctccctgccctcgtttgcagcccagctgggcggccagcggcgg
gccatcaaggcggtgctgctggaccagagcttcagcgccggcatcggcaactgggtggcc
gacgaggtgctgtaccaggcgcgcatacacccggagcagccggcgcactcggtaccgcag
gagcaggtggccgccctgcaccgagccatcagccacgtgtgccaggtggcgtgcgaggtg
gaggcagactcctccaggttcccgcccgactggctcttccaccacaggtggggaaacagc
acgccggccaaagtgggtgggcgcagcatcgaccacctcacggtcggaggccggaccagc
gcttttgtgccgtccctgcaaaagcttgac

  All links  
No link information was found.   
DBGET integrated database retrieval system