KEGG   Corynebacterium vitaeruminis: B843_11775Help
Entry
B843_11775        CDS       T03042                                 

Definition
4-aminobutyrate aminotransferase (EC:2.6.1.19)
Orthology
K07250  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
cvt  Corynebacterium vitaeruminis
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cvt00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    B843_11775
   00650 Butanoate metabolism
    B843_11775
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    B843_11775
   00280 Valine, leucine and isoleucine degradation
    B843_11775
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    B843_11775
Enzymes [BR:cvt01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     B843_11775
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     B843_11775
Amino acid related enzymes [BR:cvt01007]
 Aminotransferase (transaminase)
  Class III
   B843_11775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
complement(2622296..2623627)
Genome map
AA seq 443 aa AA seqDB search
MKDLEYHLEQTVKKADVETGGSLNQQLDERRVKAVPRALTPGLPGYVVDADGGVLVDADG
NSYIDFASGIAVTSVGASNPAVVAAVQESAAHFTHTCFMVSPYESYVAVAEKLNALTPGD
HEKKTVLLNSGAEAVENAVKIARAYTKKDAVVVFDNSYHGRTNLTMAMTAKNTPYKTGFG
PFATEVYRAPMSYPLRDGLTGEAAAARTIHMIEKEVGAENLACVVIEPIQGEGGFIVPAE
GFLPAIAAWCKDNGVVFVADEIQAGLARTGKWWAVDHESVVPDLVTIAKGIAGGMPLSAV
TGRAEIMDAPVVGGLGGTYGGNPVACAAAVAALGQMEELDLPGRAQEIEKIVREELEPLL
ELPEVAEIRGHGAMIGLEFVDADGKPNAALTKAAAKACMDAGVLILTCGMDYNVIRLLPP
LVIPEATLREGLRILAAAIRDNA
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaccttgagtaccacctcgagcagacggtgaagaaggcagatgtcgaaaccgga
ggctcgctcaaccagcagctggacgagcgtcgcgtgaaggccgtgccgcgcgccctcacc
cccgggctgccgggctacgtcgtcgatgcagacggcggcgtcttggtcgacgcggacggc
aactcctacatcgacttcgcctccggcatcgcggtgacctccgtgggcgcgtccaacccg
gcggtggtcgccgccgtccaggaatcggccgcccacttcacccacacctgcttcatggtc
tccccctacgagtcctacgtcgcggtggcagagaaactcaacgcgctcaccccgggcgac
cacgagaagaagaccgtgctcctcaactccggcgcagaggcggtggagaacgcggtgaag
atcgcgcgcgcctacaccaagaaggacgccgtcgtcgtcttcgacaactcctaccacggc
cgcacgaacctcaccatggccatgacggcgaagaacaccccgtacaagaccggtttcggc
cccttcgccaccgaggtctaccgcgcgcccatgtcctacccgctgcgcgacgggctcacc
ggcgaggcggccgccgcgcgcacgatccacatgatcgagaaggaagtcggggctgagaac
ctggcgtgcgtggtcatcgagcccatccagggcgagggcggattcatcgtcccggcggaa
ggcttcctgcccgcgatcgccgcatggtgcaaggacaatggcgtcgtcttcgtcgccgat
gaaatccaggcgggccttgcccgcaccggaaagtggtgggcggtcgaccacgagagcgtg
gttccggacctcgtcaccatcgcgaagggcattgcgggcggcatgccgctgtcggcggta
accggtcgggccgagatcatggacgcccccgtcgtcggcggcctcggcgggacctacggc
ggcaaccccgtggcttgcgccgcggcggtcgcggcgctcgggcagatggaggagcttgat
ctccccggccgcgcccaggagattgaaaagatcgttcgcgaagagctcgagcccctgctc
gagctcccggaggtcgcggagatccgcgggcacggcgcgatgatcggcctggagttcgtg
gacgcggacggcaagccgaacgccgcgctgaccaaggcggccgcgaaggcctgcatggat
gctggcgtcctcatcctcacctgcggcatggactacaacgtcattcgcctgctcccgccg
ctggtcatccctgaagccaccctgcgcgaggggctccgcatcctcgccgcagccattcgc
gacaacgcctaa

DBGET integrated database retrieval system