KEGG   Conexibacter woesei: Cwoe_0057Help
Entry
Cwoe_0057         CDS       T01153                                 

Definition
response regulator receiver modulated CheB methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
cwo  Conexibacter woesei
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:cwo02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:cwo02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
53423..54553
Genome map
AA seq 376 aa AA seqDB search
MSSATATRVVVADDSGLMRRVVTATLEHSGFTVVGAAKDGDEALALCERERPDAMTLDLA
MPGLDGIGVLRALRRQGERATPVVVVSAFSPAHGARAVDALAEGAFDLVAKPAVGDGIER
FTNELSDKVRLAAASRRGRTRPHGGRAGTGAAAAAGRAAAAPAAARPRTAAGSGAVRRAE
RRVRAHAGTRRVVVIACSTGGPKALAELVPALPAPLGAGTLIVQHMPPGFTNSLAARLDR
ASNLNVREAAGGEALDPKVALLAPGGAHLRLAEPSRVVSLSDAPEIGGLRPRADLTIADA
AKAFGERMVLVVLTGMGKDGLEGAREVRRRGGRVLVEAESTCTVYGMPRAVAEADLADEI
LPLHELPAAIAAEAGA
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagcgccactgccactcgcgtcgtcgtcgcggacgactccggcctgatgcgccgg
gtcgtcaccgcgacgctcgagcactccggcttcaccgtcgtcggcgccgccaaggacggt
gacgaggcgctcgcgctgtgcgagcgggagcgtcccgacgcgatgacgcttgacctcgcg
atgcccggcctcgacggcatcggcgtgctgagagcgctgcgccgccagggcgagcgcgcg
acgccggtcgtcgtcgtctccgccttctcgccggcgcacggcgcgcgggccgtcgacgcg
ctcgccgagggcgcgttcgacctcgtcgccaagccggccgtcggcgacggcatcgagcgc
ttcaccaacgagctgagcgacaaggtgcggctcgcggctgcctcgcgtcgtgggcgcacg
cggccgcacggcggccgcgccggcaccggcgccgctgccgccgccggtcgcgcggctgcc
gcgccggccgccgctcggccgcgcacggccgccggcagcggcgccgtccgccgcgcggag
cgccgcgtccgcgcgcacgccggcacccgccgcgtcgtcgtgatcgcctgctcgaccggc
ggcccgaaggcgctcgccgagctggtcccggcgctgccggcgccgctcggcgccggcacg
ctgatcgtccagcacatgccgcccggcttcaccaactcgctcgcggcgcggctcgaccgt
gcctccaacctcaacgtccgcgaggcggccggcggcgaggcgctcgacccgaaggtcgcg
ctgctggcaccgggcggcgcgcacctgcggctcgccgagccctcgcgcgtcgtctcgctc
agcgacgcgcccgagatcggcggcctgcgcccgcgcgcggacctgacgatcgccgacgcc
gcgaaggcattcggcgagcggatggtgctcgtcgtcttgacgggtatgggcaaggacggc
ctggagggtgcgcgggaggtccgcagacgcggcggtcgcgtgctcgtcgaggcggagtcg
acctgcaccgtctacgggatgccgcgcgccgtcgcggaggccgatctcgccgacgagatc
ctgccgctgcacgagctgcccgccgcgatcgccgcggaggccggagcatga

DBGET integrated database retrieval system