KEGG   Conexibacter woesei: Cwoe_0126Help
Entry
Cwoe_0126         CDS       T01153                                 

Definition
short-chain dehydrogenase/reductase SDR
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
cwo  Conexibacter woesei
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:cwo00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:cwo00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
125170..125922
Genome map
AA seq 250 aa AA seqDB search
MNADRRPAALVTGAAGGIGGAIVAALGDAGWDVLAVDLRPDPETGPGASFAADLTTREGN
RAAVEHALDRFGRLDAIVANAGMQHVAPVADFPEDRWDALLALMLTSPFLLAKYAWPALA
ASGDGRIVAVASAHAQVASPFKSAYVSAKHGVLGLVKTLALEGAEQGITATAVCPGFVRT
PLVEAQIGDQARAHGLPEEDVLRDVILAPHAVKRLLEPEEIAATVAFLLGPAGRAFTGVP
VTMDLGWTAR
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcagacagacggccggcggcgctcgtgacgggtgccgccggcggcatcggcggc
gcgatcgtcgccgccctcggcgacgccggctgggacgtgctcgccgtcgacctgcgcccg
gacccggagacggggccgggcgcgtcgttcgccgccgacctgaccacccgcgaggggaac
cgcgccgcggtcgagcacgcgctcgaccgcttcggccggctcgacgcgatcgtcgccaac
gccgggatgcagcacgtcgcgcccgtcgccgacttccccgaggaccgctgggacgcgctg
ctggcgctgatgctgacgagcccgttcctgctcgcgaagtacgcctggccggcgctcgcc
gcctcgggcgacggacggatcgtcgcggtcgcctcggcgcacgcgcaggtcgcctcgccg
ttcaagtcggcgtacgtgtcggccaagcacggcgtgctcgggctggtcaagacgctcgcg
ctcgaaggcgccgagcaggggatcacggcgaccgccgtctgcccgggcttcgtccgcacc
ccgctcgtcgaggcgcagatcggcgaccaggcgcgcgcgcacggcctgccggaggaggac
gtgctgcgcgacgtgatcctcgcgccgcacgccgtcaagcggctgctcgaaccggaggag
atcgccgcgaccgtcgccttcctgctcggccccgccggccgcgccttcacgggcgtgccg
gtgacgatggacctcggctggaccgcgcgctga

DBGET integrated database retrieval system