KEGG   Conexibacter woesei: Cwoe_0159Help
Entry
Cwoe_0159         CDS       T01153                                 

Definition
cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
cwo  Conexibacter woesei
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cwo00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(156079..157707)
Genome map
AA seq 542 aa AA seqDB search
MRRLAPLILAGLLLASLGAATAHAGGRMISTPLSTKGARIVDAGGRTVVLQGVNWFGFET
ANHLVHGLWARDYRDVLAQVRRLGFNTIRLPFSLEAIRSTAPVSGADFSGGRNAALKGAT
PLEAMDAVVEEAGRQGLLILLDNHSHADDAYQQGLWYGQGFSEDDWVATWKRLAARYRDQ
RNVIGADLKNEPHAEATWGTGGPTDWRRAAERAGNAVLSVAPQWLVVVEGVGGGAPVPGQ
RLDTHWWGGNLEGVRTHPVRLDRANRLVYSPHEYGPGVFPQPWFGKPNTPALLEERWRTG
FGFIAEQGIAPILVGEFGGRNVDRESAEGRWQRQFFDFIGRTGASWTYWALNPNSGDTGG
VLKDDWSSVQPAKTALLQRMIARQRIAFRGSGAVFTAPRRATTPRRGGKAAPKTPARSQT
AAPTQPSAPAQPPAQPPADDAPGPPAPGSLSARVVVENRWDAGWCGHLEVSGPDATLAAA
RATLTLPPGTRIAQSWNAQRSGDGGRVELRFPAWAKVAGGAPYAATGFCVDGSGEAADVT
VG
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgcctcgcccccctcatcctcgccggcctgctcctcgcctcgctcggcgccgcg
accgcccatgcgggtggccggatgatctccaccccgctctcgacgaagggcgcgcggatc
gtcgacgccggcggccgcacggtcgtgctgcagggggtcaactggttcggcttcgagacc
gccaaccatctcgtccacgggctgtgggcgcgcgactacagagacgtcctcgcgcaggtc
cgccggctcggcttcaacacgatccgcctgccgttctcgctggaggcgatccgctcgacg
gcaccggtctccggcgccgacttctccggcgggcggaacgccgcgctgaagggcgcgacg
ccgctcgaggcgatggacgcggtggtcgaggaggccggccgccagggcttgctgatcctg
ctcgacaaccactcgcacgcggacgacgcctaccagcagggcctctggtacggccagggc
ttcagcgaggacgactgggtcgcgacctggaagcggctcgccgctcgctaccgcgaccag
cgcaacgtgatcggcgccgacctcaagaacgagccgcacgccgaggcgacgtggggcacc
ggcgggccgaccgactggcgccgcgcggccgagcgcgccggcaacgcggtgctgtcggtc
gcgccgcagtggctcgtcgtggtcgagggcgtcggcggcggcgcgccggtccccggccag
cggctggacacgcactggtggggcggaaacctcgaaggggtccgcacgcatccggtgcgg
ctcgaccgcgccaaccggctcgtctactcgccgcacgagtacgggccgggcgtcttccca
cagccgtggttcggcaagccgaacacgccggcgctgctggaggagcgttggagaaccggc
ttcggcttcatcgccgagcaggggatcgcgccgatcctcgtcggcgagttcggcggtcgc
aacgtcgaccgggagagcgccgagggccgctggcagcggcagttcttcgacttcatcggc
cgcaccggcgcgtcgtggacgtactgggcgctgaacccgaactcgggcgacaccggaggc
gtgctgaaggacgactggtcgagcgtgcagccggcgaagaccgcgctgctccagcggatg
atcgcgcgccagcggatcgcgttccgcggcagcggcgccgtcttcaccgctccgcgccgc
gcgacgaccccgagacggggcgggaaggcggcgccgaagacgccggcgagatcgcagacg
gcggccccgacgcagccgagcgcgcccgcgcagccgcccgcacagccgcccgccgacgac
gcgcccggcccgccggcgcccggctcgctgagcgcgcgcgtcgtcgtcgagaaccgctgg
gacgccggctggtgcggtcacctcgaggtcagcggaccggacgccacgctcgcggcggca
cgcgcgacgctgacgctcccgcccggcacgcggatcgcgcagtcgtggaacgcgcagcgc
tcgggcgacggcggccgcgtcgagctgcgcttcccggcgtgggcgaaggtcgccggtggc
gcgccgtacgcggcgaccggcttctgcgtcgacggctcgggcgaggccgccgacgtgacc
gtcggctga

DBGET integrated database retrieval system