KEGG   Conexibacter woesei: Cwoe_0654Help
Entry
Cwoe_0654         CDS       T01153                                 

Definition
(RefSeq) arginase/agmatinase/formiminoglutamase
  KO
K01476  
arginase [EC:3.5.3.1]
Organism
cwo  Conexibacter woesei
Pathway
Arginine biosynthesis
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cwo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cwoe_0654
  Amino acid metabolism
   00220 Arginine biosynthesis
    Cwoe_0654
   00330 Arginine and proline metabolism
    Cwoe_0654
Enzymes [BR:cwo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Cwoe_0654
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
699235..700167
Genome map
AA seq 310 aa AA seqDB search
MTTSPFELVNRPAARPLLVIGAALDSSGSGRGEVRAAARLREAGLVERLGARDFGDLDVS
VEDPERDPRSGVIGLRDLVSASRTIRDAVASALVAGWRPLVLGGCCSVVPGTLAGVRRTL
GPASLVVVDGHLDLFDGTTSRTGEMGRMDLAIVLGHGPPELTSLDGDPPLAEASDVVAVG
DGDHPRRVTLRAPGPAEIAPDLRVIDCGEVTQRGARQVGVHVAELAGGGSAPFWLHLDVD
VVDGEAMPAVSSPVATGLSWDQVAELLAPALRSPRLIGMTVCGYNPDLDAGGEFAYCIVD
LLADGLLRSR
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
gtgaccacctcgccgttcgagctcgtcaaccgcccagcggcgcgtccgttgctcgtgatc
ggcgccgcgctcgacagctcgggctctggccgcggtgaggttcgcgcggccgcgcgcctg
cgcgaggccgggctcgtcgagcggctcggcgcgcgtgacttcggcgacctcgacgtcagc
gtcgaggacccggagcgcgacccgcgctctggcgtgatcggcttgcgcgacctcgtcagc
gcgtcgcgcacgatccgcgacgcggtcgcttcggcgctcgtggccggctggcgcccgctc
gtgctgggaggctgctgctcggtcgtcccggggacgctcgcgggcgtgcggcgcacgctc
gggccggcgtcgctcgtggtcgtcgacggtcacctcgacctgttcgacggcacgacctcg
cgcaccggcgagatgggccgcatggacctcgcgatcgtgctcggccacggtccgccggag
ctgacgtcgctcgacggcgatccgccgctggcggaggcgtccgacgtggtcgcggtcggc
gacggcgaccatcctcgccgcgtcacgctgcgtgcgccgggtccggccgagatcgcgccc
gacctgcgggtgatcgactgcggcgaggtgacgcagcgcggcgcacgccaggtcggcgtc
cacgtcgccgagctggcgggcggcggctcggcgccgttctggctgcacctggacgtggat
gtggtcgacggggaggcgatgccggcggtcagctcccccgtcgcgaccgggctgtcgtgg
gatcaggtggcggagctgctcgcgcccgcgctgcgctcaccgcggctgatcggcatgacc
gtctgcggctacaaccccgatctggacgccggcggcgagttcgcgtactgcatcgtcgac
ttgctcgcggacggtctgctgaggagccgatag

DBGET integrated database retrieval system