KEGG   Conexibacter woesei: Cwoe_0745Help
Entry
Cwoe_0745         CDS       T01153                                 

Definition
catalytic domain of components of various dehydrogenase complexes
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cwo  Conexibacter woesei
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cwo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cwoe_0745
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Cwoe_0745
  Amino acid metabolism
   00310 Lysine degradation
    Cwoe_0745
Enzymes [BR:cwo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Cwoe_0745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(788541..789740)
Genome map
AA seq 399 aa AA seqDB search
MTSSPTEQLVDVTMPQMGVSVAEGTVVEWRVAPGEAVAAEQTICEISTDKIDTEVPAPAS
GVLAEIVVQAGETVDVGTVLARIGTGAAPAHAAGNGHSRHYSPVVTRIAAEHHVDLAQVT
GTGRDGRVRKQDVLAFLDAQRAGERAAPAPAEPPLHIESPYRPEPAPAAAPAAGADPAEG
ETLSRMRRQIGAHMKRSLDTAATCTTWMEADMGRVEAARRALGTTALPLVARAAVEALRE
FPALNATLDGERYRQHDAVHLGIAVSLGEDGLIVPVIRDAQELSAEGLAVRIRDLAARAR
AKQLTPDDVAGGTFTITNPGQYGSLMATPVINQPQVAILDLEAVVKRPIVVTDDEGNDMI
AIRPQTVLGLSWDHRALDGVLAAQFLGAVRRRLESWEHH
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
gtgacctcctcgcctactgagcagctcgtcgacgtgacgatgccgcagatgggcgtgtcg
gtcgccgaggggacggtcgtcgagtggcgcgtcgcgcccggcgaggcggtcgccgccgag
cagacgatctgcgagatctcgaccgacaagatcgacacggaggtgccggcgcccgcgagc
ggtgtgctcgccgagatcgtcgtgcaggccggcgagacggtcgacgtcgggaccgtgctc
gcgcggatcggcaccggcgcggcgcccgcgcacgccgccggcaacggccacagccgccac
tactcgcccgtcgtcacgcggatcgccgccgagcaccacgtcgacctcgcgcaggtgacc
gggaccggccgcgacggacgcgtccgcaagcaggacgtgctcgccttcctcgatgcgcaa
cgcgccggcgagcgggccgctcccgctcccgccgagccgccgctccacatcgagagcccg
tacagacccgagccggcaccggccgccgcgccggcggcgggcgccgacccggccgagggc
gagacgctctcgcgcatgcgccgccagatcggcgcccacatgaagcgctcgctcgacacc
gccgccacgtgcacgacgtggatggaggcagacatgggccgcgtcgaggccgcgcgcaga
gcgctcggaacgaccgcgctcccgctcgtcgcgcgcgcggccgtcgaggcgctgcgcgag
ttcccggcgctcaacgcgacgctcgacggcgagcgctatcggcagcacgacgcggtccac
ctcggcatcgccgtctcgctcggtgaggacgggctgatcgtccccgtcatccgcgacgcg
caggagctgtcggccgaagggctcgccgtgcgcatcagagatctcgctgcgcgagcgcgc
gccaagcagctcacgcccgacgacgtcgccggcggcacgttcacgatcacgaaccccggc
caatatggctcgctgatggcgacgccggtgatcaatcagccgcaggtggcgatcctcgat
ctcgaagccgtcgtcaaacgccctatcgtggtcaccgatgacgaaggcaacgacatgatc
gcgatccgcccgcagacggtcctcgggctctcctgggaccaccgcgcgctcgacggcgtg
ctcgccgcccagttcctcggcgccgtgcggcgccggctggagagctgggagcaccactag

DBGET integrated database retrieval system