KEGG   Conexibacter woesei: Cwoe_0745Help
Entry
Cwoe_0745         CDS       T01153                                 

Definition
catalytic domain of components of various dehydrogenase complexes
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cwo  Conexibacter woesei
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cwo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cwoe_0745
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Cwoe_0745
  Amino acid metabolism
   00310 Lysine degradation
    Cwoe_0745
Enzymes [BR:cwo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Cwoe_0745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(788541..789740)
Genome map
AA seq 399 aa AA seqDB search
MTSSPTEQLVDVTMPQMGVSVAEGTVVEWRVAPGEAVAAEQTICEISTDKIDTEVPAPAS
GVLAEIVVQAGETVDVGTVLARIGTGAAPAHAAGNGHSRHYSPVVTRIAAEHHVDLAQVT
GTGRDGRVRKQDVLAFLDAQRAGERAAPAPAEPPLHIESPYRPEPAPAAAPAAGADPAEG
ETLSRMRRQIGAHMKRSLDTAATCTTWMEADMGRVEAARRALGTTALPLVARAAVEALRE
FPALNATLDGERYRQHDAVHLGIAVSLGEDGLIVPVIRDAQELSAEGLAVRIRDLAARAR
AKQLTPDDVAGGTFTITNPGQYGSLMATPVINQPQVAILDLEAVVKRPIVVTDDEGNDMI
AIRPQTVLGLSWDHRALDGVLAAQFLGAVRRRLESWEHH
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
gtgacctcctcgcctactgagcagctcgtcgacgtgacgatgccgcagatgggcgtgtcg
gtcgccgaggggacggtcgtcgagtggcgcgtcgcgcccggcgaggcggtcgccgccgag
cagacgatctgcgagatctcgaccgacaagatcgacacggaggtgccggcgcccgcgagc
ggtgtgctcgccgagatcgtcgtgcaggccggcgagacggtcgacgtcgggaccgtgctc
gcgcggatcggcaccggcgcggcgcccgcgcacgccgccggcaacggccacagccgccac
tactcgcccgtcgtcacgcggatcgccgccgagcaccacgtcgacctcgcgcaggtgacc
gggaccggccgcgacggacgcgtccgcaagcaggacgtgctcgccttcctcgatgcgcaa
cgcgccggcgagcgggccgctcccgctcccgccgagccgccgctccacatcgagagcccg
tacagacccgagccggcaccggccgccgcgccggcggcgggcgccgacccggccgagggc
gagacgctctcgcgcatgcgccgccagatcggcgcccacatgaagcgctcgctcgacacc
gccgccacgtgcacgacgtggatggaggcagacatgggccgcgtcgaggccgcgcgcaga
gcgctcggaacgaccgcgctcccgctcgtcgcgcgcgcggccgtcgaggcgctgcgcgag
ttcccggcgctcaacgcgacgctcgacggcgagcgctatcggcagcacgacgcggtccac
ctcggcatcgccgtctcgctcggtgaggacgggctgatcgtccccgtcatccgcgacgcg
caggagctgtcggccgaagggctcgccgtgcgcatcagagatctcgctgcgcgagcgcgc
gccaagcagctcacgcccgacgacgtcgccggcggcacgttcacgatcacgaaccccggc
caatatggctcgctgatggcgacgccggtgatcaatcagccgcaggtggcgatcctcgat
ctcgaagccgtcgtcaaacgccctatcgtggtcaccgatgacgaaggcaacgacatgatc
gcgatccgcccgcagacggtcctcgggctctcctgggaccaccgcgcgctcgacggcgtg
ctcgccgcccagttcctcggcgccgtgcggcgccggctggagagctgggagcaccactag

DBGET integrated database retrieval system