KEGG   Conexibacter woesei: Cwoe_0765Help
Entry
Cwoe_0765         CDS       T01153                                 

Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cwo  Conexibacter woesei
Pathway
cwo00010  Glycolysis / Gluconeogenesis
cwo00020  Citrate cycle (TCA cycle)
cwo00620  Pyruvate metabolism
cwo01100  Metabolic pathways
cwo01110  Biosynthesis of secondary metabolites
cwo01120  Microbial metabolism in diverse environments
cwo01130  Biosynthesis of antibiotics
cwo01200  Carbon metabolism
Module
cwo_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cwo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cwoe_0765
   00020 Citrate cycle (TCA cycle)
    Cwoe_0765
   00620 Pyruvate metabolism
    Cwoe_0765
Enzymes [BR:cwo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Cwoe_0765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-ProteinID: ADB49198
UniProt: D3FAC9
Position
complement(806771..808108)
Genome map
AA seq 445 aa AA seqDB search
MPDVVMPRLSDSMEEGTIIKWLKASGDEVQRGEELVEIETDKANMVYEADASGTLEIVAE
EGATLPIGEPIARLGDGSAPAAAKSAPKAAAAAKAPAPATAAPAEPAEAAPATTQTTPQP
AGGDSNGRVKASPVARRLANELGVDLAGVEGSGPGGRIVKADVEGAAKGGTATAAAPAAD
APAAAPAAEPDAATAPAKPAKEIPGPVVSGDAGSGKGEVTVQELTRTQQVIARRMAESKA
TIPDYTVTTEVDMEAAVQLREQMKAAATETLRAPSFNDMVVKAAALALREIPKANGGYRD
GKWELYGRVNVGIAVATDDALIVPTVFDADKKALGEISRDARALAARVRAGRITPPELSG
ATFTVSNLGMFGTTEFTAVIVPGQAGILSVGALRDTPVVRSGQIVPGKRMSVTITADHRI
LNGAEAAQFIARIRELLETPFSLAF
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgatgtcgtgatgccccgcctttccgactccatggaggagggcacgatcatcaag
tggttgaaggcctccggcgacgaggtccagcgcggcgaggagcttgtcgagatcgagacc
gataaggcgaacatggtctacgaggccgacgcctcgggcacgctggagatcgtcgccgaa
gagggcgcgacgctgccgatcggcgagccgatcgcgcgcctgggcgacggcagcgcaccc
gctgccgccaagagcgcgccgaaggccgccgccgcagcaaaggcgcccgcgccggccacc
gccgcgccggccgagcctgccgaggctgcgcccgcgacgacgcagacgacgccgcagccc
gccggcggcgacagcaacggccgcgtgaaggcctcgccggtcgcccgccggctcgcgaac
gagctgggcgtcgacctcgccggcgtcgagggctccggccccggcggccggatcgtgaag
gccgacgtcgagggggccgcgaagggcggcaccgcgaccgctgcggcgcccgccgccgac
gcgcccgcggccgcgccggccgccgagccggacgccgcgaccgctccggccaagcccgcg
aaggagatcccgggtccggtcgtctccggcgatgccggatccgggaagggtgaggtgacg
gtccaggagctgacgcgcacgcagcaggtgatcgcgcggcggatggcggagtcgaaggcg
acgatcccggactacaccgtgacgaccgaggtcgacatggaggccgcggtccagttgcgt
gagcagatgaaggcggctgcgaccgagacgctgcgcgcgccgtcgttcaacgacatggtc
gtcaaagccgccgcgttggcgttgcgggagatcccgaaggccaacggcggctacagagac
ggcaagtgggagctctacggccgtgtcaacgtcgggatcgcggtcgcgaccgacgacgcg
ctgatcgtcccgacggtcttcgacgccgacaagaaggcgctcggcgagatctcccgcgac
gcccgcgcgctcgcagcgcgcgtgcgggcgggcagaatcacgccgccggagctgtcgggc
gcgaccttcacggtctccaacctcggcatgttcggcacgaccgagttcaccgccgtgatc
gtccccggccaggccggcatcctctccgtcggcgcgctgcgcgacacacccgtcgtcaga
agcggccagatcgtccccggcaagcgcatgagcgtcaccatcaccgccgaccatcgcatc
ctcaacggcgccgaagccgcccaattcatcgcccgcatccgcgaactcctcgaaacaccc
ttctcgctcgctttctag

DBGET integrated database retrieval system