KEGG   Conexibacter woesei: Cwoe_0999Help
Entry
Cwoe_0999         CDS       T01153                                 

Definition
(GenBank) peptidase M42 family protein
Organism
cwo  Conexibacter woesei
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1049485..1050540
Genome map
AA seq 351 aa AA seqDB search
MATPEFLRTLLTTPGPSGYETPVAKVWREAAAAFADVSADTVGSSVARVSGTAGGPLTAV
IGHIDEIGVIVTHIDDDGFLRFEGVGGWDPIILVGQRVTLSTKDGEIDGVIGKKPIHLMK
PDDRKNVPELKDLHIDIGAKDGDDARARVRVGDVAVIAGEPVELPNDRVVSRAMDNRLGA
FVAFEAARLVAEAGGAPGDVAAVAAVQEETNLVGSRTSVFSLQPDVAIVVDVTFATDQPG
VQLGELSRQPFGSGPSITRGSMVHPVVTELLIETAEAESIPYTLSAAGRATGTDADAVHL
TRGGIPTAVVSIPLRYMHSPVEMVQLGDVHATAKLIAAFAQRVSADTSFLR
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atggccacccctgagttcctccgcacgctgctgacgacgcccgggccgtccgggtacgag
accccggtcgcgaaggtctggcgcgaggccgccgcggccttcgccgacgtgagtgccgac
acggtcggctcctcggtggcgcgcgtgagcgggacggcgggcgggccgctgaccgccgtg
atcggccacatcgacgagatcggcgtgatcgtcacccacatcgacgacgacggcttcctg
cgcttcgagggcgtcggcggctgggacccgatcatcctcgtcggccagcgcgtgacgctg
tcgaccaaggacggtgagatcgacggcgtgatcggcaagaagccgatccacctgatgaag
cccgacgaccgcaagaacgtgccggagctgaaggacctgcacatcgacatcggcgccaag
gacggcgacgacgcccgcgcgcgcgtccgcgtcggcgacgtcgccgtgatcgccggcgag
ccggtcgagctgccgaacgaccgcgtcgtctcacgtgcgatggacaaccgcctcggggcg
ttcgtcgcgttcgaggccgcacggctcgtcgccgaggccggcggcgcgccgggcgacgtc
gccgccgtcgcggcggtgcaggaggagacgaacctcgtcggctcccgcacgagcgtcttc
tcgctgcagccggacgtcgcgatcgtcgtcgacgtgacgttcgcgaccgaccagcccggc
gtccagctcggcgagctgtcgagacagccgttcgggtccggcccgtcgatcacgcgcggc
tcgatggtccacccggtcgtgaccgagctgctgatcgagacggcggaggcggagtcgatc
ccgtacacgctgtcggcggccggccgggcgaccggaaccgacgccgacgccgtccacctc
acgcgcggcggcatcccgacggcggtcgtctcgatcccgctgcgctacatgcactcgccg
gtcgagatggtccagctcggcgacgtgcacgcgaccgcgaagctgatcgccgccttcgcg
cagcgcgtctccgcggacacctcgttcctgcgctga

DBGET integrated database retrieval system