KEGG   Conexibacter woesei: Cwoe_0999Help
Entry
Cwoe_0999         CDS       T01153                                 

Definition
peptidase M42 family protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
cwo  Conexibacter woesei
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cwo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Cwoe_0999
Enzymes [BR:cwo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Cwoe_0999
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1049485..1050540
Genome map
AA seq 351 aa AA seqDB search
MATPEFLRTLLTTPGPSGYETPVAKVWREAAAAFADVSADTVGSSVARVSGTAGGPLTAV
IGHIDEIGVIVTHIDDDGFLRFEGVGGWDPIILVGQRVTLSTKDGEIDGVIGKKPIHLMK
PDDRKNVPELKDLHIDIGAKDGDDARARVRVGDVAVIAGEPVELPNDRVVSRAMDNRLGA
FVAFEAARLVAEAGGAPGDVAAVAAVQEETNLVGSRTSVFSLQPDVAIVVDVTFATDQPG
VQLGELSRQPFGSGPSITRGSMVHPVVTELLIETAEAESIPYTLSAAGRATGTDADAVHL
TRGGIPTAVVSIPLRYMHSPVEMVQLGDVHATAKLIAAFAQRVSADTSFLR
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atggccacccctgagttcctccgcacgctgctgacgacgcccgggccgtccgggtacgag
accccggtcgcgaaggtctggcgcgaggccgccgcggccttcgccgacgtgagtgccgac
acggtcggctcctcggtggcgcgcgtgagcgggacggcgggcgggccgctgaccgccgtg
atcggccacatcgacgagatcggcgtgatcgtcacccacatcgacgacgacggcttcctg
cgcttcgagggcgtcggcggctgggacccgatcatcctcgtcggccagcgcgtgacgctg
tcgaccaaggacggtgagatcgacggcgtgatcggcaagaagccgatccacctgatgaag
cccgacgaccgcaagaacgtgccggagctgaaggacctgcacatcgacatcggcgccaag
gacggcgacgacgcccgcgcgcgcgtccgcgtcggcgacgtcgccgtgatcgccggcgag
ccggtcgagctgccgaacgaccgcgtcgtctcacgtgcgatggacaaccgcctcggggcg
ttcgtcgcgttcgaggccgcacggctcgtcgccgaggccggcggcgcgccgggcgacgtc
gccgccgtcgcggcggtgcaggaggagacgaacctcgtcggctcccgcacgagcgtcttc
tcgctgcagccggacgtcgcgatcgtcgtcgacgtgacgttcgcgaccgaccagcccggc
gtccagctcggcgagctgtcgagacagccgttcgggtccggcccgtcgatcacgcgcggc
tcgatggtccacccggtcgtgaccgagctgctgatcgagacggcggaggcggagtcgatc
ccgtacacgctgtcggcggccggccgggcgaccggaaccgacgccgacgccgtccacctc
acgcgcggcggcatcccgacggcggtcgtctcgatcccgctgcgctacatgcactcgccg
gtcgagatggtccagctcggcgacgtgcacgcgaccgcgaagctgatcgccgccttcgcg
cagcgcgtctccgcggacacctcgttcctgcgctga

DBGET integrated database retrieval system