KEGG   Conexibacter woesei: Cwoe_1139Help
Entry
Cwoe_1139         CDS       T01153                                 

Definition
pyridoxal-phosphate dependent TrpB-like protein
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cwo  Conexibacter woesei
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cwo01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:cwo00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:cwo00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1197437..1198801)
Genome map
AA seq 454 aa AA seqDB search
MSAASTTFPLQERDIPTHWVNLVPDLPEPPLPPLHPGTLEPAGPDDLAAIFPPAIIAQEV
SGEPDVELPEQVREAYKLWRPTPLFRARRLERALDTPAHIYVKYEGVSPAGSHKPNSAVA
QAYENAQAGVRKLTTETGAGQWGSSLAFACSLFGLECEVWMVGSSYDQKPYRRSMMQTWG
ASVHRSPSQLTDAGRAQAAHASGSLGIAISEAVEVAARDPAANYSLGSVLNHVCLHQTVI
GQEAIAQLELAGEAPDVVVGCVGGGSNFAGLAFPFIRRVLRDGARTRFLAAEPAACPTLT
RGAYRYDFGDTVGLTPLMPMYTLGHDFVPPPVHSGGLRYHGDSPLVSALVRAGIVEARAF
RQNDAFAAALQFARTEGIVPGPEPAHAIRATVEEALAAREAGEPRVILLGLSGHGHFDLS
AYDAYLAGELEDPEFSEADMDAALARLPQAPAIG
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcggcttcgacgacgttcccgcttcaggagcgggacattccgacgcactgggtg
aacctggtgccggacctgcccgagccgccgctgccgcccctgcaccccggcacgctcgag
cctgccggacccgacgacctcgccgcgatcttcccgccggcgatcatcgcccaggaggtc
tccggcgagcccgacgtcgagctccccgagcaggtgcgcgaggcgtacaagctgtggcgg
ccgacgccgctgttccgcgcgcggcggctggagcgcgcgctcgacacgccggcgcacatc
tacgtcaagtacgagggcgtctcgccggccggctcgcacaagcccaacagcgcggtcgcg
caggcgtacgagaacgcgcaggccggggtgcgcaagctgacgaccgagaccggcgccggc
cagtggggcagctcgctggcgttcgcgtgctcgctgttcggcctcgagtgcgaggtctgg
atggtcggctcctcgtatgaccagaagccgtaccgccgctcgatgatgcagacgtggggc
gcgtcggtccaccgctcgccgtcgcagctgaccgacgccggccgcgcgcaggccgcgcac
gcgagcggctcgctcgggatcgcgatctccgaggcggtggaggtggcggcgagagacccc
gcggcgaactactcgctcggctcggtgctgaatcacgtctgcctccaccagacggtgatc
ggccaggaggcgatcgcgcaactggagctggccggcgaggcgccggacgtcgtcgtcggc
tgcgtcggcggcggctcgaacttcgcgggcctcgcgttcccgttcatccggcgcgtgctg
cgcgacggcgcgcgcacccgcttcctcgcggccgagccggccgcctgtccgacgctcacg
cgcggcgcctaccgctacgacttcggcgacacggtcgggctgacgccgctgatgccgatg
tacacgctcgggcacgacttcgtaccgccgccggtgcactcgggcggcctgcgctaccac
ggcgactcgccgctcgtcagcgcgctcgtgcgggccgggatcgtcgaggcgcgcgcgttc
agacagaacgacgccttcgccgccgcgctccagttcgcgcgcaccgaggggatcgtcccc
ggtcccgagccggcgcacgcgatccgcgcgaccgtcgaggaggcgctcgccgcgcgcgag
gccggcgagccgcgcgtgatcctgctcgggctctcgggacacggccacttcgacctgtcc
gcctacgacgcgtacctcgcgggcgagctggaggacccggagttctcggaggctgacatg
gacgccgccctcgcccggctcccgcaggcgcccgcgatcggctga

DBGET integrated database retrieval system