KEGG   Conexibacter woesei: Cwoe_1262Help
Entry
Cwoe_1262         CDS       T01153                                 

Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
cwo  Conexibacter woesei
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:cwo00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:cwo00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1324940..1326088
Genome map
AA seq 382 aa AA seqDB search
MTDMGSRHRFTFGLWTVGNPGRDPFGGPTRAPVDPVESVAKLAQLGAWGVNLHDEDLVPW
GSSPSERDRIVARFKVALGESGLDVGMATTNLFAHPAFKDGAFTSNDRRVRRAAIGKAMR
SIDLGAELGAEVYVFWGGREGTESGVAKDPRDALERYREAIDVLADYAVEQGYAMRFAIE
PKPNEPRGDNFLPTVGHALHFVSTLQRPEMVGVNPEVAHDTMAGLSIHHAVGQALWAGKL
FHIDLNSQRIGRYDQDYRFGAEDLKECFLLVRLLERAGYAGPLAFDAHAYRNESAEGVWE
FARGCMATYTALAERARHFDALPEVQEALAAASTGELTVTTVGGDGAPVLKAEADSLDAL
AERGYFNERLDQLLVEALMGVR
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgacagatatgggttcccgccaccgattcacgtttggtctgtggacggtcggcaacccc
gggcgcgatccgttcggcggtccgacgcgcgcgccggtcgaccccgtcgaatcggtcgcc
aagctcgcgcagctcggggcgtggggcgtcaacctgcacgacgaggacctcgtcccgtgg
ggttcctcgccgtccgagcgcgaccggatcgtcgcgcgcttcaaggtcgcgctcggcgaa
agcggcctggacgtcgggatggcgaccaccaacctgttcgcgcatccggccttcaaggac
ggcgccttcacgtccaacgaccggcgcgtccggcgagcggcgatcggcaaggcgatgcgc
tcgatcgatctcggtgccgagctcggcgccgaggtgtacgtgttctggggcggccgtgaa
gggacggagtccggtgtggccaaggatccgcgcgatgcgctcgagcgttaccgcgaggcg
atcgacgtcttggccgactacgccgtcgagcaggggtatgccatgcgcttcgcgatcgag
ccgaagcccaacgagccgcgcggggacaacttcctgccgacggtcggccatgccctgcac
ttcgtctcgacgttgcagcggcccgagatggtcggggtcaacccggaggtggcgcacgac
acgatggccggcctgtcgatccaccacgccgtcggtcaggcgctgtgggccggcaagctc
ttccacatcgacctcaactcgcagcgcatcggccgctacgaccaggactaccgcttcggc
gccgaggacttgaaggagtgcttcctgttggtgcggctgctggagcgcgccggctatgcg
ggcccgcttgcgttcgacgcgcacgcgtaccgcaatgagagcgcggagggcgtgtgggag
ttcgctcggggctgcatggcgacgtacacggcgctcgccgagcgggcgcgccatttcgac
gcgctccccgaggtgcaggaggcattggccgcggcatccaccggcgagctgactgtgacg
accgtcggcggcgatggggccccggtgctcaaggcagaggcggactcgctcgacgcgctc
gccgaacgcgggtacttcaatgagcgcctcgaccagctgctggtcgaggcgctcatggga
gtgcgttga

DBGET integrated database retrieval system