KEGG   Conexibacter woesei: Cwoe_1505Help
Entry
Cwoe_1505         CDS       T01153                                 

Definition
3-hydroxyacyl-CoA dehydrogenase NAD-binding protein
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
cwo  Conexibacter woesei
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:cwo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cwoe_1505
   01212 Fatty acid metabolism
    Cwoe_1505
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Cwoe_1505
   00650 Butanoate metabolism
    Cwoe_1505
  Lipid metabolism
   00071 Fatty acid degradation
    Cwoe_1505
   01040 Biosynthesis of unsaturated fatty acids
    Cwoe_1505
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Cwoe_1505
   00310 Lysine degradation
    Cwoe_1505
   00380 Tryptophan metabolism
    Cwoe_1505
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Cwoe_1505
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Cwoe_1505
   00281 Geraniol degradation
    Cwoe_1505
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    Cwoe_1505
Enzymes [BR:cwo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Cwoe_1505
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Cwoe_1505
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Cwoe_1505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1590376..1592583
Genome map
AA seq 735 aa AA seqDB search
MAESTTIRWDKDADGVVVLTLDDPNQGANTMNEAYARSMAATIDRLEAEKDSITGVIITS
AKSTFFAGGDLNNLRAVTPEQAEEFATYLREAKGQLRRLETLGKPVVAAVNGTALGGGLE
IALATHHRVVVDSSKIQLGFPEVSLGLLPGAGGVVRTVRMLGIVNALMQLLLQGKRVRPA
KALEIGIVDELVASRDDLIPAAKKWIAAKGGGDPVQQPWDADKKYKIPGGTPSTPALAMN
LPAFPANLKKQLKGANYPAPAAIMAAAIEGAQVDFDSAIEIEGRYFVSLATGQVAKNMIQ
AFFFDLQQVNGDRGRPAEIEPYRARKAVVLGAGMMGAAIAYVCAKAGIEVVLKDVSQEAA
DRGKGYSARLVEKAVSRGRSTQEKGDALLALITPTDDATAAAGADLVIEAVFEDPAVKAK
VFAEIEPHLATNALLGSNTSTLPITELAEGVSRPADFIGLHFFSPVDKMPLLEIIKGEQT
SDDALYRALDVAKQIKKTPIVVNDSRGFFTSRVIGTFINEGISMLTEGIPAPTIEQASSQ
AGYPAPVLQLSDELNLKLMRKIRVAAKEAGAIGSGWDDHPSEQVIDRMLDEFDRPGKLEG
KGFYSYADGRRTGIWDGLRAAFPPVADPSSISLRDLEERMMFIESIETVKCVDEGVIPSI
ADANIGSIFGIGFPAWSGGVLQYINGYEGGLPGFVARARELAAAYGDRFEPPASLVERAE
RGEPYLDGAGVPATA
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
atggctgagagcaccacgatccgctgggacaaggacgccgacggcgtcgtcgtcctgacg
ctggacgacccgaaccagggcgccaacacgatgaacgaggcctacgcccgttcgatggcg
gccacgatcgacagactcgaggccgagaaggactcgatcactggcgtgatcatcacctcc
gcgaagagcacgttcttcgcgggcggcgacctcaacaacctcagagcggtgacgccggag
caggcggaggagttcgccacctacctgcgcgaggcgaagggccagctgcgccgcctggag
acgctcggcaagccggtcgtcgcggcggtcaacggcaccgcgctcggcggcggcctggag
atcgcgctggcgacgcaccaccgagtcgtcgtcgacagctcgaagatccagctcggcttc
cccgaggtctcgctcggcctgcttccgggcgccggcggcgtcgtgcgcacggtccggatg
ctcggcatcgtcaacgcgctgatgcagctgctgctccagggcaagagagtccgcccggcg
aaggcgctggagatcggcatcgtcgacgagctggtcgcgagcagagacgacctgatcccc
gccgcgaagaagtggatcgccgccaagggtgggggggatccggtccagcagccgtgggac
gcggacaagaagtacaagatccccggcggcacgccgtcgacgccggcgcttgcgatgaac
ctgccggcgttcccggcgaacctgaagaagcagctgaagggcgcgaactacccggcgccc
gcggcgatcatggcggcggcgatcgagggcgcgcaggtcgacttcgacagcgcgatcgag
atcgagggccgctacttcgtcagcctcgccaccggccaggtcgcgaagaacatgatccag
gcgttcttcttcgacctccagcaggtcaacggcgaccgcggccggccggccgagatcgag
ccgtaccgggcgagaaaggccgtcgtgctcggcgccggcatgatgggcgccgcgatcgcg
tacgtctgcgcgaaggccggcatcgaggtcgtgctgaaggacgtctcgcaggaggcggcc
gaccgtggcaagggctactcggcgagactcgtcgagaaggccgtctcgcgcgggcgctcg
acgcaggagaagggcgacgcgctgctggcgctgatcaccccgaccgacgacgcgacggcc
gcggccggcgccgacctcgtgatcgaggcggtcttcgaggacccggccgtgaaggcgaag
gtcttcgccgagatcgagccgcatctggcgacgaacgcgctgctgggctcgaacacctcg
acgctcccgatcacggagctggccgagggcgtctcgcggccggcggacttcatcggcctg
cacttcttcagccccgtcgacaagatgccgctgctggagatcatcaagggcgagcagacc
tccgacgacgcgctctacagagcgctcgacgtcgccaagcagatcaagaagacgccgatc
gtcgtcaacgactcgcgcggcttcttcacctcgcgcgtgatcgggacgttcatcaacgag
ggcatctcgatgttgacggaggggatcccggcgccgacgatcgagcaggcctcctcgcag
gccggctacccggctccggtgctgcagctgtccgacgagctgaacctcaagctgatgcgc
aagatccgcgtggcggcgaaggaggccggcgcgatcggcagcggctgggacgaccatccc
tccgagcaggtgatcgaccgcatgctcgacgagttcgaccgccccggcaagctggagggg
aagggcttctactcctacgctgacggcagacggacgggcatctgggacggcctcagagcg
gccttcccgccggtcgccgacccctcttcgatctcgctcagagacctcgaggagcggatg
atgttcatcgagtcgatcgagaccgtgaagtgcgtcgacgagggcgtgatcccgtcgatc
gccgacgccaacatcggctcgatcttcgggatcggcttcccggcctggagcggcggcgtg
ctccagtacatcaacgggtacgaaggcggcctgcccggcttcgtcgcccgcgcccgcgag
ctggccgccgcctacggcgaccgcttcgagcccccggcgtcgctggtcgagcgcgccgag
cgcggcgagccctacctcgacggcgccggagtccccgccaccgcctga

DBGET integrated database retrieval system