KEGG   Conexibacter woesei: Cwoe_1676Help
Entry
Cwoe_1676         CDS       T01153                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
cwo  Conexibacter woesei
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cwo00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1763436..1763957
Genome map
AA seq 173 aa AA seqDB search
MAERIGYLGLGSNVGVPRDNLAAAVAALPAHGVRVLASSSTWETEPVGEVLDQPDFLNAC
LRIATELEPERLLDACKAVERELGRVAQESPDYVRHGPRPIDVDLLLLGELEYESERLRL
PHREVTGRRFVLAPLLELEPGLTLPDGVRLADALAALPDGQRDAVRRAGAPLL
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
gtggcggagcggatcggctacctggggctcggctccaacgtcggcgtgccgcgggacaac
ctcgcggccgccgtcgcggcgctgccggcgcacggcgtccgcgtgctcgcctcgtcctcg
acgtgggagaccgagccggtcggcgaggtgctcgaccagcccgacttcctcaacgcctgc
ctgcggatcgcgaccgagctggagcccgagcggctgctcgacgcctgcaaggcggtcgag
cgcgagctggggcgggtcgcgcaggagtcgcctgactacgtcagacacggcccgcggccg
atcgacgtcgacctgctgctgctcggcgagctggagtacgagtccgagcgtctgcggctg
ccgcaccgcgaggtgacgggccgccgcttcgtgctcgccccgctgctggagctggagccc
ggcctgacgctgccggacggcgtgcggctcgcggacgcgctcgcggcgctgccggacggc
cagagagacgcggtccgcagagcgggcgcgccgttgctctag

DBGET integrated database retrieval system