KEGG   Conexibacter woesei: Cwoe_1793Help
Entry
Cwoe_1793         CDS       T01153                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cwo  Conexibacter woesei
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cwo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cwoe_1793
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cwoe_1793
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Cwoe_1793
Enzymes [BR:cwo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Cwoe_1793
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1886225..1887244
Genome map
AA seq 339 aa AA seqDB search
MSLGLIERYRDRLPFAADDPVVTLGEGSTPLIHAAALSERVGAEVWLKYEGLNPTGSFKD
RGMTCAVSAAVREGAEAVICASTGNTSASAAAYAARAGLRCAVIVPEGKIATGKLAQALM
HGARVIALNGNFDEALQLVREVVDRHPIALVNSVNRYRLEGQKTAAFEIAEQLGPDPIDA
LCIPVGNAGNITAYWKGFNEVGHRPAMFGFQAAGAAPLVEGAPVRNPQTIATAIRIGNPA
RWEEAMNAMTSSHGAVRAVTDDQILAAYRFLASREGVFCEPASAASVAGLMTHGAGGAQR
IVCVLTGHGLKDPDTALDQVGGVLPCEPTLDAVERAVLG
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgagcctcgggctgatcgagcgctaccgcgaccgcctcccgttcgccgccgacgatccc
gtcgtcacgctcggcgagggctcgaccccgctgatccacgccgcggcgctgtccgagcgc
gtcggcgcggaggtgtggctgaagtacgaggggctgaacccgaccggctcgttcaaggac
cgcgggatgacatgtgcagtgtcggcagccgtccgcgagggcgccgaggccgtcatctgc
gcctcgaccggcaacacctccgcgagcgccgccgcctacgccgcgcgcgccggcctgcgc
tgcgcggtgatcgtgccggagggcaagatcgcgacgggcaagctcgcgcaggcgctgatg
cacggcgcccgcgtgatcgcgctcaacgggaacttcgacgaggcgctccagctcgtccgc
gaggtcgtcgaccgccatccgatcgcgctcgtcaactcggtcaacagataccgcctcgaa
gggcagaagaccgccgccttcgagatcgccgagcagctcggccccgatccgatcgacgcg
ctctgcatccccgtcggcaacgcgggcaacatcaccgcgtactggaagggcttcaacgag
gtcggccacagaccggcgatgttcggcttccaggccgccggcgcggcgccgctcgtcgag
ggcgcgccggtgcggaacccgcagacgatcgccaccgcgatccggatcggcaacccggcg
cgctgggaggaggcgatgaacgcgatgacgtcgtcgcacggcgcggtcagagccgtgacc
gacgaccagatcctcgccgcgtaccgcttcctcgcgtcgagagagggcgtcttctgcgag
ccggcctcggcggcgagcgtcgcgggcctgatgacgcacggcgccggcggcgcgcagcgg
atcgtctgcgtcctcaccggccacgggctgaaggacccggacacggcgctggaccaggtc
ggcggcgtgctcccatgcgagccgacgctcgacgccgtcgagcgggccgtgctcgggtag

DBGET integrated database retrieval system