KEGG   Conexibacter woesei: Cwoe_2349Help
Entry
Cwoe_2349         CDS       T01153                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
cwo  Conexibacter woesei
Pathway
cwo00071  Fatty acid degradation
cwo00280  Valine, leucine and isoleucine degradation
cwo00281  Geraniol degradation
cwo00310  Lysine degradation
cwo00360  Phenylalanine metabolism
cwo00362  Benzoate degradation
cwo00380  Tryptophan metabolism
cwo00410  beta-Alanine metabolism
cwo00627  Aminobenzoate degradation
cwo00640  Propanoate metabolism
cwo00650  Butanoate metabolism
cwo00903  Limonene and pinene degradation
cwo00930  Caprolactam degradation
cwo01100  Metabolic pathways
cwo01110  Biosynthesis of secondary metabolites
cwo01120  Microbial metabolism in diverse environments
cwo01130  Biosynthesis of antibiotics
cwo01212  Fatty acid metabolism
Module
cwo_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:cwo00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Cwoe_2349
   00650 Butanoate metabolism
    Cwoe_2349
  Lipid metabolism
   00071 Fatty acid degradation
    Cwoe_2349
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Cwoe_2349
   00310 Lysine degradation
    Cwoe_2349
   00360 Phenylalanine metabolism
    Cwoe_2349
   00380 Tryptophan metabolism
    Cwoe_2349
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Cwoe_2349
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Cwoe_2349
   00281 Geraniol degradation
    Cwoe_2349
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Cwoe_2349
   00627 Aminobenzoate degradation
    Cwoe_2349
   00930 Caprolactam degradation
    Cwoe_2349
Enzymes [BR:cwo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Cwoe_2349
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ADB50773
UniProt: D3F6K6
Position
complement(2485965..2486822)
Genome map
AA seq 285 aa AA seqDB search
MSAQTEADVVVTERRGAVAIVRMNRPRYRNAQNSAMTYALDDAFYAAVADDEVKAIVLAG
AGEHFSAGHDIGSPGRDTDRSFPRRAQLWWDHVGRAGAEQRMAREAEVYVGMCRRWRELP
KPTIAMVQGACVAGALMLAWSCDLIVASDDAFFADPVVRMGIPGVEYFAHPWVMGPRFAK
ELLFTGERFGAERALSLGMVNRVVPRAELEAETLALAERVAKMPRLGLALTKKAVNQAED
LMGLQSGIDSVFGLHHVAHAHNAEVGGDHLGGHDARSMRDAARPA
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcgcagacggaagcggacgtcgtcgtcaccgagcgccgcggcgcggtggcgatc
gtgcggatgaaccggccgagataccgcaacgcgcagaactccgcgatgacctacgcgctc
gacgacgccttctacgcggccgtcgccgacgacgaggtgaaggcgatcgtgctcgcgggc
gcgggcgagcacttctccgccggccacgacatcggcagccccggccgcgacaccgacagg
tcgttcccgcgccgcgcgcagctgtggtgggaccacgtcggcagagcgggcgccgagcag
cggatggcgcgcgaggccgaggtctacgtcggcatgtgccgccgttggcgcgagctgccg
aagccgacgatcgcgatggtgcagggcgcgtgcgtcgccggcgcgctgatgctggcgtgg
tcgtgcgacctgatcgtcgcctccgacgacgccttcttcgccgacccggtcgtgcggatg
gggatccccggcgtcgagtacttcgcgcacccgtgggtgatggggccgcgcttcgcgaag
gagctgctgttcaccggcgagcggttcggcgccgagcgcgcgctgtcgctcgggatggtc
aaccgcgtcgtcccgcgcgccgagctggaggcggagacgctggcgctcgccgagcgggtc
gcgaagatgccgcggctcggcctcgcgttgacgaagaaggcggtcaaccaggccgaggac
ctgatgggcctccagagcgggatcgactccgtcttcggcctccaccacgtcgcgcacgcg
cacaacgccgaggtcggcggcgaccacctcggcggccacgacgcgcgctcgatgcgcgac
gcggcgagaccggcctag

DBGET integrated database retrieval system