KEGG   Conexibacter woesei: Cwoe_2859Help
Entry
Cwoe_2859         CDS       T01153                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cwo  Conexibacter woesei
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cwo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cwoe_2859
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cwoe_2859
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cwoe_2859
Enzymes [BR:cwo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Cwoe_2859
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3051449..3052624
Genome map
AA seq 391 aa AA seqDB search
MITSVEHRFGPYGGQYVPETLMPALAELEAAWLDANRDPEYTTRLRELLTNYAGRPTPLY
LAERLSEAAGRTVYLKREDLMHTGAHKINNALGQALLAKRMGKPRVIAETGAGQHGVATA
TACALLDIDCVVYMGTEDMRRQKPNVERMRLLGATVEPVDAGTRTLKEATSAAIRDWVTN
VATTHYILGSAAGPAPFPSIVRDLQRVIGDEAREQILAAEGRLPARVIACVGGGSNAIGI
FTAFTGDRDVALVGVEAAGDGLDTPRHGAPLTKNARPGILHGAYSALMQDDEGQILEAHS
ISAGLDYPGVGPEHAHLRDTGRATYVAVTDAEALAAFQRIARLEGIIPALESSHALAWTL
ANGGGDLDVVCLSGRGDKDLAQVLDKIGGAA
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgatcacgtccgtcgaacaccgcttcggcccgtacggcgggcagtacgtgcccgagacg
ctgatgccggcgctcgcggagctggaggccgcatggctcgacgccaaccgcgaccccgag
tacacgacgcggctgcgcgagctgctgacgaactacgccggccgcccgacgccgctctac
ctcgccgagcggctcagcgaggccgccggccgcacggtgtacctcaagcgcgaggacctg
atgcacaccggcgcgcacaagatcaacaacgcgctcggacaggcgctgctcgcgaagcgg
atgggcaagccgcgcgtgatcgccgagaccggcgcgggccagcacggcgtcgcgaccgcg
accgcgtgcgcgctgctcgacatcgactgcgtcgtctacatgggcaccgaggacatgcgg
cgccagaagccgaacgtcgagcggatgcggctgctcggcgcgacggtcgagccggtcgac
gccggcacgcggacgctgaaggaggcgacctccgccgcgatccgcgactgggtcacgaac
gtcgccacgacgcactacatcctcggcagcgccgccggcccggcgccgttcccgtcgatc
gtgcgcgacctccagcgcgtgatcggcgacgaggcgcgcgagcagatcctggcggctgag
ggccggctgccggcgcgcgtgatcgcctgcgtcggcggcggctccaacgcgatcggcatc
ttcaccgcgttcaccggcgacagagacgtcgcgctggtcggcgtcgaggcggccggcgac
gggctcgacacccctcgccacggtgcgccgctgacgaagaacgcgcgtcccggcatcctc
cacggcgcctactcggcgctgatgcaggacgacgaggggcagatcctcgaagcgcactcg
atctccgccgggctcgactaccccggcgtcggccccgagcacgcccacctgcgcgacacc
ggccgtgccacctacgtcgcggtcaccgacgccgaggcgctggcggcgttccagcggatc
gcgcggctggaggggatcatcccggcgctggagtcttcgcacgcgctcgcctggacgctc
gccaacggcggcggggatctcgacgtcgtctgcctttcgggccgcggcgacaaggacctc
gcacaggtgctcgacaagatcggcggggcggcatga

DBGET integrated database retrieval system