KEGG   Conexibacter woesei: Cwoe_2860Help
Entry
Cwoe_2860         CDS       T01153                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cwo  Conexibacter woesei
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cwo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cwoe_2860
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cwoe_2860
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cwoe_2860
Enzymes [BR:cwo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Cwoe_2860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3052621..3053424
Genome map
AA seq 267 aa AA seqDB search
MSAAGTQTGIERIAQAFAGSGKRAALMPYLMGGFPDLERSLAIGEAYADGGADLVELGVP
FSDPLADGPVIHAAGTQALEAGATVAGVLEVGAKLSERVPVVLMAYANLVYGPGFEAFAD
ALVAHRISGLIVPDLPLEEAPLLLEVCDVRGIALVPLVAPTTPDERLARIGARARGFLYT
VSVTGTTGERVALDDRLGGVLSRAATATDVPVAVGFGIGTPEQAAAAADAGAAGVIVGSR
LVRAAAEADDPAAEVRSLVSAMSEALR
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcggccggcacgcagaccggcatcgagcggatcgcgcaggcgttcgccggcagc
ggcaagcgcgcggcgctgatgccgtacctgatgggcggcttccccgacctggagcgctcg
ctcgcgatcggcgaggcctacgccgacggcggcgccgacctcgtcgagctgggcgtcccg
ttctcggacccgctcgccgacggccccgtgatccatgccgccggcacgcaggcgctggag
gccggggcgaccgtcgcgggcgtgctggaggtcggcgcgaagctgtccgagcgcgtcccg
gtcgtgctgatggcgtacgcgaacctcgtctacggaccgggcttcgaggcgttcgccgac
gcgctcgtcgcgcaccgcatcagcggcctgatcgtgcccgacctgccactcgaggaggcg
ccgctgctgctggaggtctgcgacgtccgcgggatcgcgctcgtgccgctcgtcgcgccg
acgacgcccgacgagcgcctcgcgcggatcggcgcccgtgcgcgcggcttcctctacacg
gtctcggtcaccggcacgaccggcgagcgggtcgcgctcgacgaccgcctcggcggcgtg
ctgagccgcgcggcgacggcgaccgacgtccccgtcgcggtcggattcggcatcggcacg
ccggagcaggcggccgccgcggctgacgcgggcgcggccggcgtgatcgtcggcagccgt
ctcgtgcgcgccgccgcggaggccgacgaccccgccgcggaggtccgctcgctggtgagc
gcgatgtccgaggcgcttcgctag

DBGET integrated database retrieval system