KEGG   Conexibacter woesei: Cwoe_2862Help
Entry
Cwoe_2862         CDS       T01153                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
cwo  Conexibacter woesei
Pathway
cwo00010  Glycolysis / Gluconeogenesis
cwo00030  Pentose phosphate pathway
cwo00051  Fructose and mannose metabolism
cwo00052  Galactose metabolism
cwo00680  Methane metabolism
cwo01100  Metabolic pathways
cwo01110  Biosynthesis of secondary metabolites
cwo01120  Microbial metabolism in diverse environments
cwo01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cwo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cwoe_2862
   00030 Pentose phosphate pathway
    Cwoe_2862
   00051 Fructose and mannose metabolism
    Cwoe_2862
   00052 Galactose metabolism
    Cwoe_2862
  Energy metabolism
   00680 Methane metabolism
    Cwoe_2862
Enzymes [BR:cwo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Cwoe_2862
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Cwoe_2862
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: ADB51281
UniProt: D3FAW8
Position
complement(3053773..3054810)
Genome map
AA seq 345 aa AA seqDB search
MRVGILTAGGDCPGLNAVIRAAARRLMTHGHEPIGLRRGYRGLAEHDWIELDQRSVSGIL
HLGGTIVGTSNYNPFREEQGVEKVLSQQTQDPLDAVIAIGGEHTMMITRRVQEELGIPVV
GVPKTIDNDVTHTDYTFGFDTAVQIATDAIDRLHTTAQSHDRVMILEVMGRNTGWIAVYA
GIAGGADAILIPELELTVEEISAAIARRHERGKDFSIIVVAEGAQLAFESGDRRQIRTSD
DVDQYGYPRLGGIGTALAVELEERTGYETRVTSLGHVQRGGTPTATDRMLATRYGAKAAD
LVMAGETGRMVALHGTEMTSVPLGQVEGIKTIDLRYLELARTFFG
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgcgagtcggaatcctgaccgccggcggcgactgccccggcctcaacgccgtcatccgc
gccgcagcacggcgcctgatgacgcacggacacgagccgatcggcctgcgccgcggctac
cgcggactggccgagcacgactggatcgagctcgaccaacgcagcgtctcggggatcctc
cacctcggcggcacgatcgtcggcacctcgaactacaacccgttccgcgaggagcagggc
gtcgagaaggtgctcagccagcagacgcaggacccgctcgacgcggtcatcgcgatcggc
ggcgagcacacgatgatgatcacccggcgggtgcaggaggagctggggatccccgtcgtc
ggcgtgccgaagacgatcgacaacgacgtcacgcacaccgactacacgttcggcttcgac
acggccgtgcagatcgcgaccgacgcgatcgaccgcctccacaccaccgcgcagtcgcac
gaccgcgtgatgatcctcgaggtgatgggccgcaacaccggctggatcgctgtctacgcc
gggatcgccggtggcgccgacgcgatcctgatcccggagctggagctgaccgtcgaggag
atctcggcggcgatcgcacgccgccacgagcgcggcaaggacttctcgatcatcgtcgtc
gccgagggtgcgcagctcgcgttcgagagcggcgaccgcagacagatccgcacgtccgac
gacgtcgaccagtacggctacccgcgcctcggcgggatcggaaccgcgctcgcggtggag
ctggaggagcggacgggctacgagacgcgcgtcacgtcgctcggccacgtccagcgcgga
ggcacgccgacggcgaccgaccgcatgctggcgaccagatacggcgcgaaggccgccgac
ctcgtgatggccggcgagaccggccgcatggtcgctctgcacggcaccgagatgacgagc
gtcccgctcggccaggtggaggggatcaagacgatcgacctccgctatctggagctggcg
cgcaccttcttcggatag

DBGET integrated database retrieval system