KEGG   Conexibacter woesei: Cwoe_2862Help
Entry
Cwoe_2862         CDS       T01153                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cwo  Conexibacter woesei
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cwo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cwoe_2862
   01230 Biosynthesis of amino acids
    Cwoe_2862
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cwoe_2862
   00030 Pentose phosphate pathway
    Cwoe_2862
   00051 Fructose and mannose metabolism
    Cwoe_2862
   00052 Galactose metabolism
    Cwoe_2862
  Energy metabolism
   00680 Methane metabolism
    Cwoe_2862
Enzymes [BR:cwo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Cwoe_2862
Protein phosphatases and associated proteins [BR:cwo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Cwoe_2862
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3053773..3054810)
Genome map
AA seq 345 aa AA seqDB search
MRVGILTAGGDCPGLNAVIRAAARRLMTHGHEPIGLRRGYRGLAEHDWIELDQRSVSGIL
HLGGTIVGTSNYNPFREEQGVEKVLSQQTQDPLDAVIAIGGEHTMMITRRVQEELGIPVV
GVPKTIDNDVTHTDYTFGFDTAVQIATDAIDRLHTTAQSHDRVMILEVMGRNTGWIAVYA
GIAGGADAILIPELELTVEEISAAIARRHERGKDFSIIVVAEGAQLAFESGDRRQIRTSD
DVDQYGYPRLGGIGTALAVELEERTGYETRVTSLGHVQRGGTPTATDRMLATRYGAKAAD
LVMAGETGRMVALHGTEMTSVPLGQVEGIKTIDLRYLELARTFFG
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgcgagtcggaatcctgaccgccggcggcgactgccccggcctcaacgccgtcatccgc
gccgcagcacggcgcctgatgacgcacggacacgagccgatcggcctgcgccgcggctac
cgcggactggccgagcacgactggatcgagctcgaccaacgcagcgtctcggggatcctc
cacctcggcggcacgatcgtcggcacctcgaactacaacccgttccgcgaggagcagggc
gtcgagaaggtgctcagccagcagacgcaggacccgctcgacgcggtcatcgcgatcggc
ggcgagcacacgatgatgatcacccggcgggtgcaggaggagctggggatccccgtcgtc
ggcgtgccgaagacgatcgacaacgacgtcacgcacaccgactacacgttcggcttcgac
acggccgtgcagatcgcgaccgacgcgatcgaccgcctccacaccaccgcgcagtcgcac
gaccgcgtgatgatcctcgaggtgatgggccgcaacaccggctggatcgctgtctacgcc
gggatcgccggtggcgccgacgcgatcctgatcccggagctggagctgaccgtcgaggag
atctcggcggcgatcgcacgccgccacgagcgcggcaaggacttctcgatcatcgtcgtc
gccgagggtgcgcagctcgcgttcgagagcggcgaccgcagacagatccgcacgtccgac
gacgtcgaccagtacggctacccgcgcctcggcgggatcggaaccgcgctcgcggtggag
ctggaggagcggacgggctacgagacgcgcgtcacgtcgctcggccacgtccagcgcgga
ggcacgccgacggcgaccgaccgcatgctggcgaccagatacggcgcgaaggccgccgac
ctcgtgatggccggcgagaccggccgcatggtcgctctgcacggcaccgagatgacgagc
gtcccgctcggccaggtggaggggatcaagacgatcgacctccgctatctggagctggcg
cgcaccttcttcggatag

DBGET integrated database retrieval system