KEGG   Conexibacter woesei: Cwoe_2862Help
Entry
Cwoe_2862         CDS       T01153                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cwo  Conexibacter woesei
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:cwo01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:cwo01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cwo00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:cwo00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:cwo00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:cwo00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:cwo00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3053773..3054810)
Genome map
AA seq 345 aa AA seqDB search
MRVGILTAGGDCPGLNAVIRAAARRLMTHGHEPIGLRRGYRGLAEHDWIELDQRSVSGIL
HLGGTIVGTSNYNPFREEQGVEKVLSQQTQDPLDAVIAIGGEHTMMITRRVQEELGIPVV
GVPKTIDNDVTHTDYTFGFDTAVQIATDAIDRLHTTAQSHDRVMILEVMGRNTGWIAVYA
GIAGGADAILIPELELTVEEISAAIARRHERGKDFSIIVVAEGAQLAFESGDRRQIRTSD
DVDQYGYPRLGGIGTALAVELEERTGYETRVTSLGHVQRGGTPTATDRMLATRYGAKAAD
LVMAGETGRMVALHGTEMTSVPLGQVEGIKTIDLRYLELARTFFG
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgcgagtcggaatcctgaccgccggcggcgactgccccggcctcaacgccgtcatccgc
gccgcagcacggcgcctgatgacgcacggacacgagccgatcggcctgcgccgcggctac
cgcggactggccgagcacgactggatcgagctcgaccaacgcagcgtctcggggatcctc
cacctcggcggcacgatcgtcggcacctcgaactacaacccgttccgcgaggagcagggc
gtcgagaaggtgctcagccagcagacgcaggacccgctcgacgcggtcatcgcgatcggc
ggcgagcacacgatgatgatcacccggcgggtgcaggaggagctggggatccccgtcgtc
ggcgtgccgaagacgatcgacaacgacgtcacgcacaccgactacacgttcggcttcgac
acggccgtgcagatcgcgaccgacgcgatcgaccgcctccacaccaccgcgcagtcgcac
gaccgcgtgatgatcctcgaggtgatgggccgcaacaccggctggatcgctgtctacgcc
gggatcgccggtggcgccgacgcgatcctgatcccggagctggagctgaccgtcgaggag
atctcggcggcgatcgcacgccgccacgagcgcggcaaggacttctcgatcatcgtcgtc
gccgagggtgcgcagctcgcgttcgagagcggcgaccgcagacagatccgcacgtccgac
gacgtcgaccagtacggctacccgcgcctcggcgggatcggaaccgcgctcgcggtggag
ctggaggagcggacgggctacgagacgcgcgtcacgtcgctcggccacgtccagcgcgga
ggcacgccgacggcgaccgaccgcatgctggcgaccagatacggcgcgaaggccgccgac
ctcgtgatggccggcgagaccggccgcatggtcgctctgcacggcaccgagatgacgagc
gtcccgctcggccaggtggaggggatcaagacgatcgacctccgctatctggagctggcg
cgcaccttcttcggatag

DBGET integrated database retrieval system