KEGG   Conexibacter woesei: Cwoe_3078Help
Entry
Cwoe_3078         CDS       T01153                                 

Definition
Na-Ca exchanger/integrin-beta4
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
cwo  Conexibacter woesei
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cwo00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3283514..3284923)
Genome map
AA seq 469 aa AA seqDB search
MPQPLLRLVLLALAALALAPAAASARGSVQLTSSQFTVNEGDGDAVITVVRDDAGGAGQV
RYDAYYDRSAEANQDWKPVQGRIEFAPGQREASFRIPIVDDTIVEASETVKVGIYGPHPM
RLGEPNRGILTIVDNDAVGAERDPLNPLGLDVAPTNGNPLQGARFFVDEEWGLAQMAIKR
YRRTNPGAASQLRVIAEQPETKRFGTWTKNPRHELATYLQRVQTEDPGAVPLVATYRLKH
LECGGVSDSAADAESYKRWYDEFAAGVGNQRIVLFYEIDALITTRCLSRAGLNRRTEEVR
YAIDVLSKLPHAVVYVDAGSGLAHQPRYIAWLLRRVGVHKIEGFFTNATHQNTTRREIAY
GRLLVRLLGGRPRFVVNTSSNGQGPLVPRDRVKEGNSYRCNAPGRGLGPKPTSAVPPQYR
SLDGLFWIGNPGRSAGGCGRAFFARIPPTGAFWLEYALQLIRHADFRIR
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgccccagcctctgctccgtctcgtgctgctcgcgctcgccgcgctggcactcgctccc
gccgcggcgtccgcgcgcggcagcgtgcagctcacctccagccaattcaccgtgaacgaa
ggtgacggcgatgccgtcatcacggtcgtgcgcgacgatgccggcggtgccggccaggtc
cgctacgacgcgtactacgaccgcagcgccgaggcgaaccaggactggaagcccgtccag
ggccggatcgagttcgccccgggccagcgcgaggcgtcgttccggatcccgatcgtcgac
gacacgatcgtcgaggcgtccgagacggtgaaggtcgggatctacggcccgcatccgatg
cggctcggcgagcccaaccgcggcatcctgacgatcgtcgacaacgacgccgtcggcgcc
gagcgcgacccgctcaacccgctcggcctcgacgtcgcgccgacgaacggcaacccgctc
cagggcgcgcgcttcttcgtcgacgaggagtggggcctggcgcagatggcgatcaagaga
taccgccggacgaatccgggcgcggcctcccagctgcgcgtgatcgccgagcagcctgag
acgaagcgcttcggcacgtggacgaagaacccgcgccacgagctcgcgacctacctccag
cgcgtccagaccgaggaccccggcgcggtgccgctggtcgcgacctaccgtctcaagcac
ctcgagtgcggcggcgtcagcgactccgccgccgacgccgagtcgtacaagcgctggtac
gacgagttcgccgcgggcgtcggcaaccagcggatcgtcctcttctacgagatcgacgcg
ctgatcacgaccagatgcctctcgcgtgccggcctgaaccgccgcaccgaggaggtccgc
tatgcgatcgacgtgctttcgaagctcccccacgcggtcgtctacgtcgacgccggcagc
ggcctggcgcaccagccgcggtacatagcctggctgctgagacgcgtcggcgtccacaag
atcgagggcttcttcacgaacgccacgcaccagaacacgacgcggcgcgagatcgcctac
ggccgcctgctggtccgcctgctcggcggcagaccgcgcttcgtcgtcaacacgtcgagc
aacggccagggcccgctcgtcccgagagaccgcgtcaaggaggggaactcctaccgctgc
aacgctcccggacgcggcctcggccccaagccgacgtccgccgtgccgccgcagtaccgc
agcctcgacggcctcttctggatcggcaaccccggccgctccgccggcggctgcggcaga
gcgttcttcgccagaatcccgccgaccggcgccttctggctggagtacgcgctccagctg
atcagacacgccgacttccgcatccgctga

DBGET integrated database retrieval system