KEGG   Conexibacter woesei: Cwoe_3180Help
Entry
Cwoe_3180         CDS       T01153                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
cwo  Conexibacter woesei
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:cwo03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3385486..3386082
Genome map
AA seq 198 aa AA seqDB search
MIALVRGEVAGRRPAAPAGGDVVVDVNGVGYRLAVSSETLKQVPAAGKRVTLHSHLIVRD
DALQLYGFATEEERDLFLMLLGVQSVGPKVALAVLSGGTPRELLGALAAGDAARFQAVPG
IGKRTAERIIVELREKAGVAVPDDAVHGSVASDDPRTLAREGLVGLGFSLDEAERLLKRA
PGETAEELIAHALRTSRR
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgcgctcgtccgcggcgaggtcgccgggcggcgccccgccgcgccggccgggggg
gacgtcgtcgtcgacgtcaacggcgtcgggtaccgcctggcggtgtcatccgagacgctg
aagcaggtgccggcggccggcaagagggtcaccctccacagccacctgatcgtgcgcgac
gacgcgctccagctctacggcttcgcgaccgaggaggagcgtgacctcttcctgatgctg
ctcggcgtccagtcggtcggcccgaaggtcgcgctcgccgtcctctcgggcggcacgccg
cgcgagctgctcggcgcgctcgccgccggcgacgccgcccgcttccaggctgtgcccggg
atcggcaagcgcaccgcggagcggatcatcgtcgagctgcgcgagaaggccggcgtcgcc
gtgcccgacgacgcggtccacggcagcgtggcgagcgacgacccgcgcacgctcgcgcgc
gaaggcctcgtcggcctcggcttctcgctcgacgaggccgagaggctgctcaagagagcg
ccgggcgagaccgccgaagagctgatcgcccacgccctgcggacgtcgcggcgatga

DBGET integrated database retrieval system