KEGG   Conexibacter woesei: Cwoe_3191Help
Entry
Cwoe_3191         CDS       T01153                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cwo  Conexibacter woesei
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cwo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cwoe_3191
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cwoe_3191
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Cwoe_3191
Enzymes [BR:cwo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Cwoe_3191
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3400746..3401981
Genome map
AA seq 411 aa AA seqDB search
MPPVSLTCKECKTVYELEAKYVCERCFGPLEVAYAAPTDVDADELRRRIQAGPHSLWRYR
DFLPLAGAPPRDTLPAGWTPLLRADRLAERLGIGELWIKNDAANPTHSFKDRVVAVALAR
AKELGFQTIACASTGNLANAVAAHAAAAGLDSYVFIPSDLEEQKILATGVYGTNLVAVRG
NYDDVNRLCTEVAGEHEWAFVNINMRPYYSEGSKTIAYEIAEQLGWSVPDRIVAPIASGS
LFTKVAKGFEEWIELGLVDGAVPTMNGAQATGCSPVATAFGEGTDICRPVKPDTIAKSLA
IGNPADGPYAVELARKTGGGIDAVTDDEIRAGIKLLAETTGIFTETAGGVTTAVLAKLAA
RGDIDASERVVAVITGEGLKTLDVVRGTFETHLIEPSYEAFEAVVPGAVAA
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgccgccagtgtcactgacctgcaaagaatgcaagaccgtctatgagctcgaggcgaag
tacgtctgcgagcgctgcttcggtcccctcgaagtcgcctacgcggcgccgaccgatgtc
gacgccgacgagctgcgccgccgcatccaggcggggccgcactcgctgtggcgctaccgc
gacttcctcccgctcgccggcgcgccgccgcgcgacacgctgccggccgggtggacgccg
ctgctgcgcgccgaccggctcgcggagcggctcggcatcggcgagctgtggatcaagaac
gacgccgcgaacccgacgcactcgttcaaggatcgcgtcgtcgccgtcgcgctcgcgcgt
gcgaaggagctgggcttccagacgatcgcgtgcgcatcgaccggcaacctcgccaacgcc
gtcgccgcgcacgccgcggcggccggcctcgactcctacgtcttcatcccgtccgacctc
gaggagcagaagatcctcgcgaccggcgtctacggcacgaacctcgtcgccgtcagaggg
aactacgacgacgtcaaccgcctctgcaccgaggtcgctggcgagcacgaatgggcgttc
gtgaacatcaacatgcgcccgtactactccgagggctccaagacgatcgcgtacgagatc
gccgagcagctcggctggtcggtccctgatcggatcgtcgcgccgatcgcctccggctcg
ctcttcacgaaggtcgcgaagggcttcgaggagtggatcgagctgggtctcgtagacggc
gcggtgccgacgatgaacggcgcacaggcgaccggctgctcgcccgtcgccactgcgttc
ggcgagggcaccgacatctgccgtccggtcaagccggacacgatcgccaagtccctcgcg
atcggcaacccggccgacgggccgtacgcggtcgagctggcgcgcaagaccggcggcggg
atcgacgccgtcaccgacgacgagatccgcgccggcatcaagctgctggccgagacgacg
ggcatcttcaccgagacggcgggcggcgtcacgacggcggtgctcgcgaagctcgccgca
cgcggcgacatcgacgccagcgagagagtcgtcgccgtcatcaccggcgagggcctgaag
acgctcgacgtcgtgcgcggcacgttcgagacgcacctgatcgaaccgagctacgaggcg
ttcgaggcggtcgtccccggcgcggtggccgcctga

DBGET integrated database retrieval system