KEGG   Conexibacter woesei: Cwoe_3200Help
Entry
Cwoe_3200         CDS       T01153                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
cwo  Conexibacter woesei
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:cwo00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:cwo00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3406363..3407307
Genome map
AA seq 314 aa AA seqDB search
MKHLLSIDDLDRAGIERVLDRAASFAEVAGREIKKVPALRGRTVVNLFYEASTRTSSSFE
LAAKRLSADLVSIRAASSSVTKGESLKDTIATLTAYDPAAIVIRSPHAGAAQLVAGWTDA
AVVNAGDGKHEHPTQALLDVFTLRQKLGSLDGVKIWIVGDVLHSRVARSDILAFTRMGAH
VTLSGPPTLIPRGIEALGCDVEPTLDRLPEADVVYVLRMQHERMKEAYVPSLREYAMRYQ
IDTNRLQPHQVLMHPGPVNRGVELSGDAIDSPQALIGQQVEAGVVVRMAVLYELLAGAGA
AKSPIGSVETAVAA
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
gtgaagcatctcctgtcgatcgacgacctcgaccgcgccggcatcgagcgcgtgctcgac
cgcgccgcctccttcgcagaggtcgccggtcgcgagatcaagaaggtgcccgcgctgcgc
gggcgcacggtcgtgaacctcttctacgaggcctcgacgcgcacgagcagctcgttcgag
ctggccgccaagcggctctcggccgacctcgtctcgatccgcgccgcctcctccagcgtc
acgaagggcgagtcgctgaaggacacgatcgcgacgctgaccgcctacgacccagccgcg
atcgtgatccgctcgccgcacgccggcgccgcgcaactggtcgccggctggaccgacgcc
gccgtcgtcaacgccggcgacggcaagcacgagcacccgacgcaggcgctgctcgacgtc
ttcacgctgcggcagaagctcggctcgctcgacggcgtcaagatctggatcgtcggcgac
gtgctgcactcgcgcgtcgcgcggtcggacatcctcgcgttcacgcggatgggcgcgcac
gtgacgctcagcggaccgccgacgctgatcccgcgcgggatcgaggcgctcggctgcgac
gtcgagccgacgctcgatcggcttcccgaggcggacgtggtctacgtcctgcgcatgcag
cacgaacggatgaaggaggcgtacgtgccgtcattgcgcgagtacgcgatgcgataccag
atcgacacgaaccggctccaaccgcaccaggtgctgatgcacccgggtccggtcaaccgc
ggggtcgagctgtcgggcgacgcgatcgactcgccgcaggcgctgatcggccagcaggtc
gaggccggcgtcgtcgtgcggatggcggtgctgtacgagctgctcgcgggcgccggtgcg
gcgaagtcgccgatcggcagcgtcgagacggcggtggccgcgtga

DBGET integrated database retrieval system