KEGG   Conexibacter woesei: Cwoe_3200Help
Entry
Cwoe_3200         CDS       T01153                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
cwo  Conexibacter woesei
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cwo00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Cwoe_3200
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Cwoe_3200
Enzymes [BR:cwo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Cwoe_3200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3406363..3407307
Genome map
AA seq 314 aa AA seqDB search
MKHLLSIDDLDRAGIERVLDRAASFAEVAGREIKKVPALRGRTVVNLFYEASTRTSSSFE
LAAKRLSADLVSIRAASSSVTKGESLKDTIATLTAYDPAAIVIRSPHAGAAQLVAGWTDA
AVVNAGDGKHEHPTQALLDVFTLRQKLGSLDGVKIWIVGDVLHSRVARSDILAFTRMGAH
VTLSGPPTLIPRGIEALGCDVEPTLDRLPEADVVYVLRMQHERMKEAYVPSLREYAMRYQ
IDTNRLQPHQVLMHPGPVNRGVELSGDAIDSPQALIGQQVEAGVVVRMAVLYELLAGAGA
AKSPIGSVETAVAA
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
gtgaagcatctcctgtcgatcgacgacctcgaccgcgccggcatcgagcgcgtgctcgac
cgcgccgcctccttcgcagaggtcgccggtcgcgagatcaagaaggtgcccgcgctgcgc
gggcgcacggtcgtgaacctcttctacgaggcctcgacgcgcacgagcagctcgttcgag
ctggccgccaagcggctctcggccgacctcgtctcgatccgcgccgcctcctccagcgtc
acgaagggcgagtcgctgaaggacacgatcgcgacgctgaccgcctacgacccagccgcg
atcgtgatccgctcgccgcacgccggcgccgcgcaactggtcgccggctggaccgacgcc
gccgtcgtcaacgccggcgacggcaagcacgagcacccgacgcaggcgctgctcgacgtc
ttcacgctgcggcagaagctcggctcgctcgacggcgtcaagatctggatcgtcggcgac
gtgctgcactcgcgcgtcgcgcggtcggacatcctcgcgttcacgcggatgggcgcgcac
gtgacgctcagcggaccgccgacgctgatcccgcgcgggatcgaggcgctcggctgcgac
gtcgagccgacgctcgatcggcttcccgaggcggacgtggtctacgtcctgcgcatgcag
cacgaacggatgaaggaggcgtacgtgccgtcattgcgcgagtacgcgatgcgataccag
atcgacacgaaccggctccaaccgcaccaggtgctgatgcacccgggtccggtcaaccgc
ggggtcgagctgtcgggcgacgcgatcgactcgccgcaggcgctgatcggccagcaggtc
gaggccggcgtcgtcgtgcggatggcggtgctgtacgagctgctcgcgggcgccggtgcg
gcgaagtcgccgatcggcagcgtcgagacggcggtggccgcgtga

DBGET integrated database retrieval system