KEGG   Conexibacter woesei: Cwoe_3534Help
Entry
Cwoe_3534         CDS       T01153                                 

Definition
(GenBank) UDP-N-acetylglucosamine1-carboxyvinyltransferase
  KO
K00790  UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
cwo  Conexibacter woesei
Pathway
cwo00520  Amino sugar and nucleotide sugar metabolism
cwo00550  Peptidoglycan biosynthesis
cwo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cwo00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Cwoe_3534
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Cwoe_3534
Enzymes [BR:cwo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Cwoe_3534
Peptidoglycan biosynthesis and degradation proteins [BR:cwo01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   Cwoe_3534
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EPSP_synthase
Motif
Other DBs
NCBI-ProteinID: ADB51952
UniProt: D3F092
Position
complement(3754792..3756096)
Genome map
AA seq 434 aa AA seqDB search
MEKFVIQGGVPLSGTFVPAGNKNGALPILAAALLTDEEVVIRNVPRISDVQAQIELIADL
GARAEWIGDNEVAIRADGVAKTDLDRRLSERIRASFLLAGPLLARFGRAHMPPPGGDVIG
RRRLDPHLDAFKALGATIEHDRDILLTAPRGLTACDFLMDEPSVMATENALMAAALTPGS
TIIRNAASEPHVQDLARMLVKMGAQIDGIGSNVMTVHGVDRLGGCDHRVAPDHIEIGSFM
ALAGVTGGELTIKDTYPEDLRMVRLVFARLGLETDMRGNDLFVPGGQKLVITNDAGGYQP
KVEDGPWPAFPADLTSIALALATQSEGSVIIHEKMFENRLFFTDKLQLMGAAITICDPHR
ALVVGSRRLRGERVESPDIRAGMAMLIAALCAEGTTEIGNIRQIDRGYERIDERLRALGA
RIERVEDGDRIHAH
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagttcgtcatacagggcggcgtgccgctttcaggcacgttcgtgcccgcaggc
aacaagaacggtgcgctgccgatcctcgccgcggcgttgctgaccgacgaagaagtcgtg
atccgcaacgtcccgcgcatcagcgacgtgcaggcgcagatcgagctgatcgccgacctc
ggcgcgcgcgccgagtggatcggcgacaacgaggtcgcgatccgcgccgacggcgtcgcc
aagaccgatctcgaccgcaggctgtccgagcggatccgtgcgtcgttcctgctcgccggc
ccgctgctcgcgcgcttcgggcgcgcgcacatgccgccgcccggcggcgacgtgatcggc
cgtcgccggctcgacccgcacctcgacgcgttcaaggcgctcggcgcgacgatcgagcac
gaccgcgacatcctgctgaccgccccgcgcggcctcacggcctgcgacttcctgatggac
gagccgtccgtgatggcgacggagaacgcgctgatggccgccgcgctgacgcccggctcg
acgatcatccgcaacgccgcttccgagccgcacgtgcaggacctcgcgcgcatgctcgtg
aagatgggcgcgcagatcgacgggatcggctccaacgtgatgaccgtccacggcgtcgac
cggctcggcggctgtgaccaccgcgtcgcccccgaccacatcgagatcggctccttcatg
gcgctcgccggcgtgaccggcggcgagctgacgatcaaggacacctatcccgaggacctg
cggatggtccgcctcgtcttcgcccgcctcggcctcgagaccgatatgcgcggcaacgac
ctgttcgtccccggcggtcagaagctcgtcatcaccaacgacgccggcggctaccagccg
aaggtcgaggacggcccgtggccggcgttccccgccgatctgacgagcatcgcgctcgcg
ctggcgacgcagtcggaggggtcggtcatcatccacgagaagatgttcgagaaccgcctc
ttcttcacggacaagctgcagctgatgggcgccgcgatcacgatctgcgatccgcaccgc
gcgctcgtcgtcggctcccgccgcctgcgcggcgagcgcgtcgagtcgcccgacatccgc
gccggcatggcgatgctgatcgccgcgctctgcgccgagggcaccaccgagatcggcaac
atccgccagatcgaccgcggctacgagcggatcgacgagcgcctgcgcgcgctcggcgcc
cgcatcgagcgggtcgaggacggcgaccggatccacgcccactag

DBGET integrated database retrieval system