KEGG   Conexibacter woesei: Cwoe_3621Help
Entry
Cwoe_3621         CDS       T01153                                 

Definition
glycoside hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
cwo  Conexibacter woesei
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cwo00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Cwoe_3621
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    Cwoe_3621
Enzymes [BR:cwo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Cwoe_3621
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3854424..3855527)
Genome map
AA seq 367 aa AA seqDB search
MIATLLAAFATAVGAVTGAAPAASPTPVATAAGPAASLPLDQAVGQRMIGSLPGTTVPDA
LARQIRRGQLAGVILFARNVGSRAQLRALTDRLQAERRRGPRALRDRPLLIMIDQEGGLV
KRLPGAPAQSAGDLGARNDPALARRAGLATARNLSGVGVNVNLAPVLDLGLPGSYQRSTE
RSYAATAAGVSRIGGAFADGLRDGGVLATAKHFPGLGRGPANEDERLNRIDVPLDLLRAT
DEAPFRDAARRGVPFVMVSTGIYPALDERPAMFSERVTTRELRDVVGFRGVTVTDDLEVS
AIAHLTPERKALASVRAGNDLLLFCQTAAAADRGAAALVRAVRSGAIERASIDAGADRVL
ALRAGLR
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgatcgccacgctgctcgccgccttcgcgaccgcggtcggcgccgtcaccggcgccgca
cccgctgcgtcgccgacacccgtcgcgaccgctgccggtccggcggcgtcgcttccgctc
gaccaggcggtcgggcagcggatgatcggctcgctgcccggcacgaccgtgcccgacgcg
ctcgcgcggcagatccgccgcgggcagctcgcgggcgtgatcctgttcgcgcgcaacgtc
ggctcgcgcgcgcagctgcgcgcgctgaccgaccggctccaggccgagcggcggcgcggc
ccgcgcgcgctgcgcgaccgcccgctgctgatcatgatcgaccaggagggcgggctcgtg
aagcggctcccgggtgcgccggcgcagtcggccggcgacctcggcgcgcgtaacgatccc
gcgctcgcccgtcgcgccggtctcgcgaccgcccgcaacctgagcggggtgggggtcaac
gtcaacctcgcgccggtgctcgacctcgggctgccgggctcctatcagcgctccaccgag
cgctcctacgccgccaccgccgccggcgtcagccggatcggcggcgcgttcgccgacgga
ctgagagacggcggcgtgctcgcgaccgccaagcacttccctggcctcggccgcggcccg
gcgaacgaggacgagcggctcaaccgcatcgacgtcccgctcgacttgctgcgcgcgacc
gacgaggcgccgttcagagacgccgcccgccgcggcgtcccgttcgtgatggtctcgacg
gggatctaccccgcgctcgacgagcgcccggcgatgttctccgagcgcgtcacgacccgc
gagctgcgcgacgtcgtcggcttcagaggggtgaccgtcaccgacgacctcgaggtctcc
gcgatcgcgcacctgacgcccgagcgcaaggcgctcgcgtcggtccgcgccggcaacgac
ctgctgctgttctgccagaccgcggccgccgccgaccgcggtgccgcggcgctcgtgcgc
gcggtccggagcggcgcgatcgaacgtgcgagcatcgacgcgggcgccgaccgggtgctc
gcgctccgcgccgggctgcggtga

DBGET integrated database retrieval system