KEGG   Conexibacter woesei: Cwoe_4024Help
Entry
Cwoe_4024         CDS       T01153                                 

Definition
pyridoxal-5'-phosphate-dependent protein subunit beta
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
cwo  Conexibacter woesei
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:cwo00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Cwoe_4024
Enzymes [BR:cwo01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.15  D-cysteine desulfhydrase
     Cwoe_4024
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4278008..4279036)
Genome map
AA seq 342 aa AA seqDB search
MSALHERFPPLRETLPHVPLGSRPTPVRPLPQLADGGAPVWVKDEGRFGDGGWGGNKVRK
LEWLIPDAERRGRRTILTFGGLGTNWGLAAALYARDRGLATALALVDQPLDDHVRAQLAR
LHSSGATLHFTRTKARTVARVPLLLARHADGARLPYVLPAGGSSPVGTLGYVEVALELAA
QVRDGALPAPSHVVTAVGTGGTAAGLLLGLRIAGLPTRVVGVVVNDRLRLDARTIAGLAR
RTARLLRRRGAALPRFPFAEDDVLLVRDWLGRSYGHATPEGERAQALAASRAGLALEPVY
TAKAMAALLALNAADRFGAGPLLFLHTDGPRTIALDEGSTAL
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcgcttcacgagcggttcccgccgttgcgcgagacgctgccgcacgtcccgctc
ggcagccgcccgacgccggtgcggccgctgccgcagctggcggacggcggcgcgcctgtg
tgggtcaaggacgaggggcgcttcggcgacggcggctggggcggcaacaaggtgcgcaag
ctcgaatggctgatccccgacgccgagcggcgtggccgccggacgatcctgacgttcggc
gggctggggacgaactgggggctcgcggccgccctgtacgcgcgcgaccgcgggctcgcg
acggcgctcgcgctcgtcgaccagccgctcgacgaccacgtccgcgcccagctggcgcgc
ctgcacagctccggcgcgacgctccacttcactcgcacgaaggcgcggacggtcgcgcgc
gtgccgctgctgctggcgcggcacgccgacggcgcccggctcccgtacgtgctcccggcc
ggcgggtcctcgccggtcggcacgctcgggtacgtcgaggtcgcgctggagctggccgcg
caggtccgcgacggcgcgctgccggcgccgtcgcacgtcgtgacggccgtcggcaccggc
ggcacggccgcggggctgctgctcggcctgcggatcgccgggctgccgacgcgcgtcgtc
ggcgtcgtcgtcaacgacagactgcggctcgacgcgcgcacgatcgccgggctcgcgcgg
cggaccgcgcggctgctgcgccgacgcggcgcggcgctgccgcggttcccgttcgcggag
gacgacgtgctgctcgtgcgcgactggctcgggcgctcgtacggtcacgcgacgcccgag
ggcgagcgcgcccaggcgctggcggcgtcgcgcgccggcctcgcgctcgaaccggtgtac
acggcgaaggcgatggccgcgctgctggcgctgaacgcagccgaccgcttcggggcaggc
ccgctgctgttcctccacaccgacgggccgcgcaccatcgcacttgacgaaggttcgaca
gcactctag

DBGET integrated database retrieval system