KEGG   Conexibacter woesei: Cwoe_4024Help
Entry
Cwoe_4024         CDS       T01153                                 

Definition
pyridoxal-5'-phosphate-dependent protein subunit beta
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
cwo  Conexibacter woesei
Pathway
Cysteine and methionine metabolism
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:cwo00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4278008..4279036)
Genome map
AA seq 342 aa AA seqDB search
MSALHERFPPLRETLPHVPLGSRPTPVRPLPQLADGGAPVWVKDEGRFGDGGWGGNKVRK
LEWLIPDAERRGRRTILTFGGLGTNWGLAAALYARDRGLATALALVDQPLDDHVRAQLAR
LHSSGATLHFTRTKARTVARVPLLLARHADGARLPYVLPAGGSSPVGTLGYVEVALELAA
QVRDGALPAPSHVVTAVGTGGTAAGLLLGLRIAGLPTRVVGVVVNDRLRLDARTIAGLAR
RTARLLRRRGAALPRFPFAEDDVLLVRDWLGRSYGHATPEGERAQALAASRAGLALEPVY
TAKAMAALLALNAADRFGAGPLLFLHTDGPRTIALDEGSTAL
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcgcttcacgagcggttcccgccgttgcgcgagacgctgccgcacgtcccgctc
ggcagccgcccgacgccggtgcggccgctgccgcagctggcggacggcggcgcgcctgtg
tgggtcaaggacgaggggcgcttcggcgacggcggctggggcggcaacaaggtgcgcaag
ctcgaatggctgatccccgacgccgagcggcgtggccgccggacgatcctgacgttcggc
gggctggggacgaactgggggctcgcggccgccctgtacgcgcgcgaccgcgggctcgcg
acggcgctcgcgctcgtcgaccagccgctcgacgaccacgtccgcgcccagctggcgcgc
ctgcacagctccggcgcgacgctccacttcactcgcacgaaggcgcggacggtcgcgcgc
gtgccgctgctgctggcgcggcacgccgacggcgcccggctcccgtacgtgctcccggcc
ggcgggtcctcgccggtcggcacgctcgggtacgtcgaggtcgcgctggagctggccgcg
caggtccgcgacggcgcgctgccggcgccgtcgcacgtcgtgacggccgtcggcaccggc
ggcacggccgcggggctgctgctcggcctgcggatcgccgggctgccgacgcgcgtcgtc
ggcgtcgtcgtcaacgacagactgcggctcgacgcgcgcacgatcgccgggctcgcgcgg
cggaccgcgcggctgctgcgccgacgcggcgcggcgctgccgcggttcccgttcgcggag
gacgacgtgctgctcgtgcgcgactggctcgggcgctcgtacggtcacgcgacgcccgag
ggcgagcgcgcccaggcgctggcggcgtcgcgcgccggcctcgcgctcgaaccggtgtac
acggcgaaggcgatggccgcgctgctggcgctgaacgcagccgaccgcttcggggcaggc
ccgctgctgttcctccacaccgacgggccgcgcaccatcgcacttgacgaaggttcgaca
gcactctag

DBGET integrated database retrieval system