KEGG   Conexibacter woesei: Cwoe_4089Help
Entry
Cwoe_4089         CDS       T01153                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
cwo  Conexibacter woesei
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:cwo00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4341065..4341769)
Genome map
AA seq 234 aa AA seqDB search
MSAPWRARRAALRRDRALIEAARGLEEHGLVVGTVGNVSVRDGARVRITPTKLAYDRLRP
YDLVTVDLAGRRWEGRRHPSRELALHLAIYRARGDVQAIVHAHGTHAAAWSFLGVPLEPA
IEESAYYGIGPVAVSRHAPAGSGELGRTAARALGRSSAALLGGHGLVAVGADPARALLVA
RVVEHHAQVAWLLRGEGRSAGAGEGLRVPERRMRESTNGHDSAGTTGVSDILRR
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcgccgtggcgcgcccgccgcgccgcgctgcgccgcgaccgcgcgctgatcgag
gcggcgcgcgggctggaggagcacggcctcgtcgtcgggacggtcggcaacgtcagcgtc
cgcgacggcgcgcgcgtccggatcacgccgaccaagctggcctacgaccgcctgcgtccg
tacgacctcgtcaccgtcgacctcgccggcaggcgctgggagggccggcgccacccgtcg
cgcgagctggcgctccacctcgcgatctaccgcgcgcgcggggacgtgcaggcgatcgtc
cacgcccacggcacgcacgccgcggcgtggagcttcctcggcgtcccgctggagccggcg
atcgaggagtcggcctattacggcatcggcccggtcgccgtctcacggcacgcgccggcc
ggcagcggggaactgggccggaccgctgcgcgggcgctcggcaggtcgtccgccgcgctg
ctcggcggccacgggctcgtcgccgtcggggccgacccggcccgcgcgctgctcgtcgcc
cgcgtcgtcgagcaccacgcccaggtcgcctggctgctgcgtggggagggccgttcggct
ggcgcgggggaggggctgcgcgtgccggagagacgtatgagagagtccacgaacggtcac
gattcggccggtaccaccggagtatccgatatcctgaggcgctga

DBGET integrated database retrieval system