KEGG   Conexibacter woesei: Cwoe_4105Help
Entry
Cwoe_4105         CDS       T01153                                 

Definition
(2Fe-2S)-binding domain-containing protein
Orthology
K03518  
carbon-monoxide dehydrogenase small subunit [EC:1.2.99.2]
Organism
cwo  Conexibacter woesei
Pathway
Nitrotoluene degradation
Methane metabolism
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cwo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cwoe_4105
  Energy metabolism
   00680 Methane metabolism
    Cwoe_4105
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Cwoe_4105
Enzymes [BR:cwo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.99  With other acceptors
    1.2.99.2  carbon-monoxide dehydrogenase (acceptor)
     Cwoe_4105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4362124..4362630
Genome map
AA seq 168 aa AA seqDB search
MSKVEVTLRVNGRVYEDVCEPRRTLADFLRRNCGLTGTHLGCEHGVCGACTVRLNGDTVR
SCLMLAVQAQDAEITTVEGLAAADGSLSPLQEAFHEHHGLQCGFCTPGMLLAAQELLEQS
PDPSEEEIRASLSGNLCRCTGYEFIVDAVRDAAGRLGADATAPAEVRS
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaggtcgaggtcacgctgcgcgtcaacgggcgcgtctacgaggacgtctgcgag
ccgcgccgcacgctggcggacttcctgcgccgcaactgcggcctgaccggcacccatctc
ggctgcgagcacggcgtctgcggcgcctgcacggtgcggctgaacggtgacaccgtccgc
tcgtgcctgatgctcgcggtccaggcgcaggacgccgagatcacgacggtcgagggactc
gccgcggcagacggctcgctgtcgccgttgcaggaggcgttccacgagcaccacgggctg
cagtgcggcttctgcacgccggggatgttgctggccgcccaggagctgttggagcagagc
cccgacccctccgaggaggagatccgcgcgtcgctgtcgggcaacctctgccgctgcacg
ggctacgagttcatcgtcgacgcggtgcgcgacgcggcggggcggctcggtgcggatgcc
actgctccggcggaggtccgctcgtga

DBGET integrated database retrieval system