KEGG   Conexibacter woesei: Cwoe_4105Help
Entry
Cwoe_4105         CDS       T01153                                 

Definition
(GenBank) (2Fe-2S)-binding domain protein
  KO
K03518  
aerobic carbon-monoxide dehydrogenase small subunit [EC:1.2.5.3]
Organism
cwo  Conexibacter woesei
Brite
Enzymes [BR:cwo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.5  With a quinone or similar compound as acceptor
    1.2.5.3  aerobic carbon monoxide dehydrogenase
     Cwoe_4105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
4362124..4362630
Genome map
AA seq 168 aa AA seqDB search
MSKVEVTLRVNGRVYEDVCEPRRTLADFLRRNCGLTGTHLGCEHGVCGACTVRLNGDTVR
SCLMLAVQAQDAEITTVEGLAAADGSLSPLQEAFHEHHGLQCGFCTPGMLLAAQELLEQS
PDPSEEEIRASLSGNLCRCTGYEFIVDAVRDAAGRLGADATAPAEVRS
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaggtcgaggtcacgctgcgcgtcaacgggcgcgtctacgaggacgtctgcgag
ccgcgccgcacgctggcggacttcctgcgccgcaactgcggcctgaccggcacccatctc
ggctgcgagcacggcgtctgcggcgcctgcacggtgcggctgaacggtgacaccgtccgc
tcgtgcctgatgctcgcggtccaggcgcaggacgccgagatcacgacggtcgagggactc
gccgcggcagacggctcgctgtcgccgttgcaggaggcgttccacgagcaccacgggctg
cagtgcggcttctgcacgccggggatgttgctggccgcccaggagctgttggagcagagc
cccgacccctccgaggaggagatccgcgcgtcgctgtcgggcaacctctgccgctgcacg
ggctacgagttcatcgtcgacgcggtgcgcgacgcggcggggcggctcggtgcggatgcc
actgctccggcggaggtccgctcgtga

DBGET integrated database retrieval system