KEGG   Conexibacter woesei: Cwoe_4105Help
Entry
Cwoe_4105         CDS       T01153                                 

Definition
(2Fe-2S)-binding domain-containing protein
Orthology
K03518  
carbon-monoxide dehydrogenase small subunit [EC:1.2.99.2]
Organism
cwo  Conexibacter woesei
Pathway
Nitrotoluene degradation
Methane metabolism
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:cwo01200]
Metabolism; Energy metabolism; Methane metabolism [PATH:cwo00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation [PATH:cwo00633]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4362124..4362630
Genome map
AA seq 168 aa AA seqDB search
MSKVEVTLRVNGRVYEDVCEPRRTLADFLRRNCGLTGTHLGCEHGVCGACTVRLNGDTVR
SCLMLAVQAQDAEITTVEGLAAADGSLSPLQEAFHEHHGLQCGFCTPGMLLAAQELLEQS
PDPSEEEIRASLSGNLCRCTGYEFIVDAVRDAAGRLGADATAPAEVRS
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaggtcgaggtcacgctgcgcgtcaacgggcgcgtctacgaggacgtctgcgag
ccgcgccgcacgctggcggacttcctgcgccgcaactgcggcctgaccggcacccatctc
ggctgcgagcacggcgtctgcggcgcctgcacggtgcggctgaacggtgacaccgtccgc
tcgtgcctgatgctcgcggtccaggcgcaggacgccgagatcacgacggtcgagggactc
gccgcggcagacggctcgctgtcgccgttgcaggaggcgttccacgagcaccacgggctg
cagtgcggcttctgcacgccggggatgttgctggccgcccaggagctgttggagcagagc
cccgacccctccgaggaggagatccgcgcgtcgctgtcgggcaacctctgccgctgcacg
ggctacgagttcatcgtcgacgcggtgcgcgacgcggcggggcggctcggtgcggatgcc
actgctccggcggaggtccgctcgtga

DBGET integrated database retrieval system