KEGG   Conexibacter woesei: Cwoe_4226Help
Entry
Cwoe_4226         CDS       T01153                                 

Definition
glucose-methanol-choline oxidoreductase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
cwo  Conexibacter woesei
Class
Metabolism; Xenobiotics biodegradation and metabolism; Steroid degradation
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4486769..4488409)
Genome map
AA seq 546 aa AA seqDB search
MEERAGRFDYDWLVVGSGFGGSVSALRLAEKGYRVGVLECGRRFRDDEIPRSTWDLRRYF
WMPRLGMRGMMRITTFKDVAVVSGSGVGGGSLGYANTLYVPPRAFFVDPQWGALNDWESA
LAPHYAEAQRMLGVVVHGDDDPADDLLRQLGEELGVGETYRKTPVGVYFGRPGVTVPDPY
FGGDGPARTGCTHCGRCMVGCPVGAKNTLVKNYLWFAERRGAQITPDRTVIDVRPLGAAD
GSDGYAITHVPSGSWLEQDKVTVTARGVVVAAGALGTNRLLQRCRMKGSLPKLSRRLGEL
VRTNSEAILAVTVPKDYADDLTQRIAITGSIYPDPNTHIETVTYGKAGGAMSFMYTLLVG
DGTRVTRPLKLLGAALRNPGRFVKLLWPGGWSRRTIIVLVMQTLDNAIALRPRRALIGGG
VRLQTEQDSARPNPTFIPIANQTAEWLAEKTGGVAQSSIMEAVNIPSTAHILGGAAIGAT
PQDGVVDARQRVYGYENLLVCDGAAVPANVGVNPSLTITAMAEHAMSHIPPASATPAPPE
PVAAPA
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atggaggagagagcaggacgcttcgactacgactggctcgtcgtcggatcggggttcggc
ggcagcgtctccgcgctgcgactggcggagaagggctaccgcgtcggcgtgctcgaatgc
ggccgccgcttccgcgacgacgagatcccgagatcgacgtgggatctgcggcgctacttc
tggatgccgcggctcgggatgcgcgggatgatgcggatcacgaccttcaaggacgtcgcc
gtcgtcagcggcagcggcgtcggcggcggctcgctcggctacgccaacacgctctacgtg
ccgccgagagcgttcttcgtcgacccgcagtggggcgcgctgaacgactgggagtcggcg
ctcgcgccgcactacgccgaggcgcagcggatgctcggcgtcgtcgtccacggcgacgac
gacccggccgacgacctgctgcgccagctcggcgaggagctgggcgtcggcgagacgtac
agaaagacgcctgtcggcgtctacttcggcagacccggcgtgaccgtcccggacccgtac
ttcggcggcgacggaccggcgcgcaccggctgcacccactgcggccgctgcatggtcggc
tgtccggtcggggcgaagaacacgctcgtgaagaactacctctggttcgcggagagacgc
ggcgcgcagatcacgcccgaccgcacggtgatcgatgtgcgcccgctcggcgccgccgac
ggcagcgacggctacgcgatcacccatgtcccgtccggctcctggctcgagcaggacaag
gtgacggtgaccgcgcgcggcgtcgtcgtcgcggccggcgcgctcggcaccaacagactg
ctccagcgctgccgcatgaagggctcgctgccgaagctctcgcgtcggctcggcgagctg
gtccgcaccaacagcgaggcgatcctcgcggtgacggtgccgaaggactacgccgacgac
ctgacgcagcggatcgcgatcaccggctcgatctacccggacccgaacacgcacatcgag
acggttacgtacggcaaggccggcggcgcgatgtcgttcatgtacaccctgctcgtcggc
gacggcacgcgcgtgacgcgcccgctgaagctgctcggcgcggcgctgcgcaatcccggc
agattcgtgaagctgctgtggcccggcggctggtcgcgccgcacgatcatcgtgctcgtg
atgcagacgctcgacaacgcgatcgcgctgcgcccgagacgggcgctgatcggcggcgga
gtgcggctgcagaccgagcaggacagcgccagaccgaacccgacgttcatcccgatcgcg
aaccagacggccgagtggctggcggagaagacgggcggcgtcgcgcagtcgtcgatcatg
gaggcggtcaacatcccgtcgaccgcgcacatcctcggcggcgccgcgatcggtgcgacg
ccgcaggacggcgtcgtcgacgcccgccagcgcgtctacggctacgagaacctgctcgtc
tgcgacggcgcggcggtgcccgccaacgtcggcgtcaacccgagcctcacgatcaccgcg
atggccgagcacgcgatgagccacatcccgccggcctccgccacgccggctccgcccgag
ccggtcgccgcccccgcctga

DBGET integrated database retrieval system