KEGG   Conexibacter woesei: Cwoe_4275Help
Entry
Cwoe_4275         CDS       T01153                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
cwo  Conexibacter woesei
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:cwo00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4549802..4550767)
Genome map
AA seq 321 aa AA seqDB search
MIDPLSRWAQYGEKPDYAGLLTFAGQPYTEDPAELAGVDVAVIGAPTDDLVSDRPGTRFG
PRAIRAASCPPGPHLEAGIDAFSVLRVVDYGDAPVLPADAARSAEAIERTVGEALAAGAI
PVVLGGDHSIAEADVRACAAVHGPLGLVHFDTHTDTGREVFGVPRSHGTPMYRLVEDGHV
DGSRYVQIGLRGYWPGDDEFGWQREHGITSLFMHEIRDRGIASIVDRAVEVLGDGPTFLT
VDVDVLDPAFAPGTGTPEPGGMTPADLLWACRTLAHRLRLVGMDVVEVIPTGVGSADVTA
LVAERIVRETLTGIAQRRRDG
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatccactctcacgttgggcgcagtacggcgagaagccggactacgcggggctg
ctgacgttcgccgggcagccgtacaccgaggatccggcggagctggccggcgtcgacgtg
gcggtgatcggcgcaccgaccgacgacctcgtctccgaccggccgggcacgcgtttcggc
ccgcgcgcgatccgcgcggcgagctgcccgcccggtccgcacctggaggcggggatcgac
gcgttctccgtgctgcgcgtcgtcgactacggcgacgcgccggtgctgccggccgacgcg
gcgcgctcggcggaggcgatcgagcggacggtgggggaggcgctggcggcgggcgcgatc
ccggtcgtgctcggcggcgaccactcgatcgcggaggcggacgtgcgcgcctgcgcggcg
gtccacggtccgctcgggctcgtccacttcgacacgcacacggacacgggcagagaggtc
ttcggcgtcccccgctcgcacggcacgccgatgtaccggctggtcgaggacggccacgtc
gacggctcgcgctacgtgcagatcggcctgcgcggctactggcctggcgacgacgagttc
ggctggcagcgcgagcacgggatcacgtcgctgttcatgcacgagatccgcgaccgcggg
atcgcttcgatcgtcgaccgcgcggtcgaggtgctcggcgacgggccgacgttcctgacc
gtcgacgtcgacgtgctcgacccggcgttcgcgcccgggacggggacgccggagccgggc
gggatgacgcccgccgacctgctgtgggcgtgccgcacgctcgcgcaccgcctgcggctc
gtcgggatggacgtcgtcgaggtgatcccgaccggcgtcggctccgccgacgtcaccgcg
ctcgtcgccgagcggatcgtgcgcgagaccttgaccggcatcgcgcagcggcggcgcgac
ggctga

DBGET integrated database retrieval system