KEGG   Conexibacter woesei: Cwoe_4287Help
Entry
Cwoe_4287         CDS       T01153                                 

Definition
ricin B lectin
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
cwo  Conexibacter woesei
Pathway
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cwo00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Cwoe_4287
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Cwoe_4287
Enzymes [BR:cwo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Cwoe_4287
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4563041..4564984)
Genome map
AA seq 647 aa AA seqDB search
MSSPRREIVSSRPRSAWRSVVLAAGAAMALAVVPSSALAVGETLNVWQTGGSGSSGLTPQ
TDVRLGSPARGTYNVEVDDSKVTQTVDGGFGASFTDSSAYLLMRLKASNPSGYSTLMNKI
FGTAAADGIGLRFWRVPMTSSDFTAARSHWTSRDSSGSPFALSAQDTGRIIPVIRDALAI
NPNLRIMASPWSAPGWMKSNGSMICNTGSGNSTLLPAHYQDWADYFVSWIRAYESNGIPI
WGVSAQNEPGYCPNNYPGMTWTPAAEGAWVANYLRPSLTRAGLSKQILGFDHNWEFFANP
LALMNGSAASFDGLAWHCYDNPSDPAAMTKLRNLFPTKSVYETECSSDTTPTDIIRYGTA
DMTLKSVQNWAQGVITWNLALDQTGGPQLGGCVGCVGLITIDSATSAVTLRNNYFQLGQI
SKFVAPGARHIASTVDAHGIVTAAFKNPDGQEVLVAHNTNATSTSFTVSWNGRGSFNYTL
PSRGTVTFRGTVPAATSLPATPAAGRTFKFVSRTSGKPFGVSGASTANGARVVQWLDNSD
WDQQWRLVDAGGGYWNLINRNSGLGLDNGGTSTDGVQMQQWAVVGTGNFNQQWQITAASS
GYYRIVNRTSGKSLDVRDGSLAEDAAIQQWTTYSGEPNQEFQLVPTS
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagtccgaggagagagatcgtgtccagcaggcccaggagcgcctggcgctcagtc
gtgctcgcagccggtgccgcgatggcgctggcggtcgtcccgtcgtccgcgctggcggtc
ggcgagacgctcaacgtctggcagaccggcggcagcggatcgagcggcttgacgccgcag
accgacgtcagactcggcagtcccgcgcgcgggacgtacaacgtcgaggtcgacgacagc
aaggtgacgcagacggtcgacggcggcttcggcgcctccttcaccgactcctccgcgtac
ctgctgatgagactgaaggcgtcgaacccgagcggctactcgacgctgatgaacaagatc
ttcgggacggccgccgcggacggcatcgggctgcgcttctggcgcgtgccgatgacctcc
tcggacttcacggccgcgagatcgcactggacctcgcgcgacagctccggctcgccgttc
gcgctcagcgcgcaggacaccggccgcatcatcccggtgatcagagacgcgctcgcgatc
aacccgaacctgcggatcatggcgagcccgtggagcgcgcccggctggatgaagtccaac
ggctcgatgatctgcaacaccggctcgggcaacagcacgctgctgccggcgcactaccag
gactgggcggactacttcgtcagctggatcagagcgtacgagtccaacgggatcccgatc
tggggcgtcagcgcgcagaacgagcccggctactgcccgaacaactaccccggcatgacg
tggacgccggcggccgagggcgcctgggtcgccaactacctgcgcccgtcgctgacgaga
gcgggcctcagcaagcagatcctcggcttcgaccacaactgggagttcttcgccaatccg
ctcgcgctgatgaacggcagcgcggcgagcttcgacggactcgcgtggcactgctacgac
aaccccagcgacccggccgcgatgacgaagctgcggaacctgttcccgaccaagagcgtc
tacgagaccgagtgctcgtcggacacgaccccgacggacatcatcagatacggcacggcc
gacatgacgctgaagtcggtgcagaactgggcgcagggcgtgatcacctggaacctcgcg
ctcgaccagacgggcggcccgcagctcggcggctgcgtcggctgcgtcgggctgatcacg
atcgactccgcgacgagcgcggtgacgctgcgcaacaactacttccagctcggtcagatc
tcgaagttcgtcgcgcccggcgcgagacacatcgcatcgaccgtcgacgcgcacgggatc
gtcaccgccgcgttcaagaaccccgacggccaggaggtgctcgtcgcccacaacacgaac
gcgacgtcgacctcgttcaccgtcagctggaacggcagaggctcgttcaactacacgctc
ccgtcgcgcggcacggtgaccttccgcggcacggtgccggcggcgacctcgctgccggcg
acgcccgccgcggggcggacgttcaagttcgtcagccgcacgagcggcaagccgttcggc
gtctccggcgcctcgacggcgaacggcgcgagagtcgtccagtggctcgacaacagcgac
tgggaccagcagtggagactcgtcgacgccggcggcggctactggaacctgatcaaccgc
aacagcggcctcgggctcgacaacggcggcacctcgaccgacggcgtgcagatgcagcag
tgggcggtcgtcgggaccggcaacttcaaccagcagtggcagatcacggcggccagctcc
ggctattaccggatcgtcaaccgcacgagcggcaagtcgctcgacgtcagagacggcagc
ctcgccgaggacgccgcgatccagcagtggacgacgtacagcggtgagcccaaccaggag
ttccagctcgtcccgacgagctga

DBGET integrated database retrieval system