KEGG   Conexibacter woesei: Cwoe_4397Help
Entry
Cwoe_4397         CDS       T01153                                 

Definition
catalytic domain of components of various dehydrogenase complexes
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cwo  Conexibacter woesei
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:cwo01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cwo00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:cwo00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:cwo00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4682800..4684008)
Genome map
AA seq 402 aa AA seqDB search
MSVAEIEFRLADIGEGLTEADVVEWLVPVGERVEEHQPVVTVETDKALVELPAPATGVIT
WHAVEAGTSAAVGDVLFKIEAEGVTHTTHTTPPTPAAEQATPAPPRGRVLAAPATRKLAY
ELGIDLTTVQGSGPHGRITKHDVRAAQEPASGAPGGGGATEPVRPRAPRGEDRTTVLSGV
KRSMARAMTRAWRVPHVSEFREVDAARLLAVQKTLRADAERAGVRLAFAPIFAMVTVAAL
REHPIMNAVYDEGTETVTERGSVDLGIAAATPDGLVVPVVRAAEQLTLLELAREIDALAE
AARTRRLTREQTGPGSFTLTNTGAYGGWLGVPIVRAPEVGIAGFGRTRESAVVVDGEIVA
RPLLPLSVSADHRVVEGAELSAFISTLERLIAEPSRLLLGAV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtggccgagatcgagttcagactggccgacatcggcgagggcctgaccgaggcc
gacgtcgtcgagtggctggtccccgtcggggagcgcgtcgaggagcaccagccggtcgtg
accgtcgagaccgacaaggcgctcgtcgaactgcccgcgccggcgaccggcgtcatcacc
tggcacgcggtcgaggccggcacgtccgccgccgtcggcgacgtgctgttcaagatcgaa
gcggagggcgtcacgcacacgacgcacacgacgccgccgacgccggctgccgagcaggcg
acgcccgccccgcctcgcggccgcgtcctcgcggcaccggcgacccgcaagctggcgtac
gagctgggcatcgacctgacgaccgtccagggctccgggccccacgggcggatcaccaag
cacgacgtgcgcgccgcgcaggaacccgccagcggcgcgcccggcggcggcggcgcgacg
gagcccgtccgaccgcgcgctccgcgcggcgaggatcgcaccacggtcctcagcggcgtc
aagcgctcgatggcccgcgcgatgacacgggcgtggagagttccccacgtcagcgagttc
cgcgaggtcgacgctgcgcggctgctcgccgtgcagaagacgctgcgcgccgacgcggag
cgggctggcgtgcgcctcgcgttcgcgccgatcttcgcgatggtcaccgtcgcggctctg
cgcgagcacccgatcatgaacgccgtctacgacgaggggaccgagacggtcaccgagcgc
ggcagcgtcgacctcggcatcgccgcggcgaccccggacggcctcgtcgtgccggtggtg
cgcgcggccgaacagctcacgctgctggagctggcgcgcgagatcgacgcgctcgcggag
gccgcccgcacgcggcgcctgacgcgcgaacagaccggaccggggtccttcacgctcacc
aacaccggcgcgtacggcggctggctcggcgtgccgatcgtgcgcgcgccggaggtcggc
atcgccggcttcggccgtacgcgcgagtcggcggtcgtcgtggacggcgagatcgtggcg
cggcccctgctgccgctgtcggtgtcggccgaccaccgtgtcgtcgagggggcggagctg
agcgcgttcatctcgacgctcgaacgcctgatcgcggagccgtcgcgactgctgctggga
gctgtgtga

DBGET integrated database retrieval system