KEGG   Conexibacter woesei: Cwoe_4401Help
Entry
Cwoe_4401         CDS       T01153                                 

Definition
(RefSeq) catalytic domain of components of various dehydrogenase complexes
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cwo  Conexibacter woesei
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cwo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cwoe_4401
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Cwoe_4401
  Amino acid metabolism
   00310 Lysine degradation
    Cwoe_4401
Enzymes [BR:cwo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Cwoe_4401
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4687388..4688596)
Genome map
AA seq 402 aa AA seqDB search
MLLPQMGTSVVEGTVIGWSKAIGDTVAVDETLCEISTDKVDTECPSPVAGTLAEILVQDG
ETVEVGTAIARIAAEAGASPAAPAAAPTPATAPARAANGAIDGYVSPVVSRMAQEHQIDL
AQITGTGRRGRITKRDVVAHLAAGPGEPKEERPLHSESPYRPDPPVEAPTAPRPSPARAT
TEPLSRMRQSIGSAMLRSQEVAATCHTVVECDMFHVERRRRELGVTALPIVARAVVETLR
EFPELNATLEGTAITRYEGVQLGIAVSLGDDGLIVPVIRDAQDLAPEGIAQAIKEIARRA
RDRQLAPDDVRGASFTITNPGAAGAVFATPIINVPQVAILDLEAIVRRPTIVTGADGTES
IAIRPMANLILGWDHRAIDGMYAARFLTALRTRLEDPHGRPD
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
gtgctgttgccgcagatggggacgtccgtcgtcgaagggaccgtcatcggctggtcgaag
gcgatcggcgacacggtggccgtggacgagacgctgtgcgagatctccaccgacaaggtc
gacaccgagtgcccgtcgccggtggccgggacgctcgcggagatcctcgtccaggacggc
gagaccgtcgaggtcggcaccgcgatcgcacggatcgccgccgaggccggagcgtcacct
gcggcgccggctgctgccccgacgccggccactgccccggcgcgggccgcgaacggcgcg
atcgacggctacgtctccccggtcgtgtcccggatggcgcaggagcaccagatcgacctc
gcccagatcaccggaaccggccgccgcggtcggatcacgaaacgcgatgtggtcgcacac
ctcgccgccggtcccggcgagcccaaggaggagcgaccgctgcacagcgaatcgccctac
cggccggaccctcccgtcgaggcgcccaccgcgccgcgcccgtcgccggcccgcgcaacg
acggagccgctgtcgcggatgcgccagagcatcggcagcgcgatgctccgctcgcaggag
gtcgccgcgacctgccacacggtcgtcgagtgcgacatgttccacgtcgaacgccgccgg
cgcgagctgggcgtgaccgcgctgccgatcgtggcccgcgccgtcgtcgagacgttgcgc
gagttccccgagctcaacgcgacgctggagggcaccgcgatcacgcgctacgagggggtt
cagctcgggatcgccgtctcgctcggcgacgacgggctgatcgtgccggtgatccgcgac
gctcaggacctggcgcccgaggggatcgcccaggcgatcaaggagatcgcacgccgggct
cgtgacagacagctcgccccggacgacgtccgcggtgcgagcttcacgatcacgaacccc
ggagcggcgggagcggtgttcgcgacgccgatcatcaacgtgccgcaggtcgcgatcctc
gacctcgaagcgatcgtccggcggcccacgatcgtgaccggcgccgacggcaccgagtcg
atcgcgatccggccgatggcgaacctgatcctcggctgggaccaccgtgcgatcgacggc
atgtacgcggcacggttcctcactgcgctgcgcacgcggctcgaggacccgcacggccgt
cccgattga

DBGET integrated database retrieval system