KEGG   Conexibacter woesei: Cwoe_4401Help
Entry
Cwoe_4401         CDS       T01153                                 

Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cwo  Conexibacter woesei
Pathway
cwo00020  Citrate cycle (TCA cycle)
cwo00310  Lysine degradation
cwo01100  Metabolic pathways
cwo01110  Biosynthesis of secondary metabolites
cwo01120  Microbial metabolism in diverse environments
cwo01130  Biosynthesis of antibiotics
cwo01200  Carbon metabolism
Module
cwo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cwo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cwo00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Cwoe_4401
  Amino acid metabolism
   00310 Lysine degradation
    Cwoe_4401
Enzymes [BR:cwo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Cwoe_4401
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 CodY
Motif
Other DBs
NCBI-ProteinID: ADB52815
UniProt: D3F7S1
Position
complement(4687388..4688596)
Genome map
AA seq 402 aa AA seqDB search
MLLPQMGTSVVEGTVIGWSKAIGDTVAVDETLCEISTDKVDTECPSPVAGTLAEILVQDG
ETVEVGTAIARIAAEAGASPAAPAAAPTPATAPARAANGAIDGYVSPVVSRMAQEHQIDL
AQITGTGRRGRITKRDVVAHLAAGPGEPKEERPLHSESPYRPDPPVEAPTAPRPSPARAT
TEPLSRMRQSIGSAMLRSQEVAATCHTVVECDMFHVERRRRELGVTALPIVARAVVETLR
EFPELNATLEGTAITRYEGVQLGIAVSLGDDGLIVPVIRDAQDLAPEGIAQAIKEIARRA
RDRQLAPDDVRGASFTITNPGAAGAVFATPIINVPQVAILDLEAIVRRPTIVTGADGTES
IAIRPMANLILGWDHRAIDGMYAARFLTALRTRLEDPHGRPD
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
gtgctgttgccgcagatggggacgtccgtcgtcgaagggaccgtcatcggctggtcgaag
gcgatcggcgacacggtggccgtggacgagacgctgtgcgagatctccaccgacaaggtc
gacaccgagtgcccgtcgccggtggccgggacgctcgcggagatcctcgtccaggacggc
gagaccgtcgaggtcggcaccgcgatcgcacggatcgccgccgaggccggagcgtcacct
gcggcgccggctgctgccccgacgccggccactgccccggcgcgggccgcgaacggcgcg
atcgacggctacgtctccccggtcgtgtcccggatggcgcaggagcaccagatcgacctc
gcccagatcaccggaaccggccgccgcggtcggatcacgaaacgcgatgtggtcgcacac
ctcgccgccggtcccggcgagcccaaggaggagcgaccgctgcacagcgaatcgccctac
cggccggaccctcccgtcgaggcgcccaccgcgccgcgcccgtcgccggcccgcgcaacg
acggagccgctgtcgcggatgcgccagagcatcggcagcgcgatgctccgctcgcaggag
gtcgccgcgacctgccacacggtcgtcgagtgcgacatgttccacgtcgaacgccgccgg
cgcgagctgggcgtgaccgcgctgccgatcgtggcccgcgccgtcgtcgagacgttgcgc
gagttccccgagctcaacgcgacgctggagggcaccgcgatcacgcgctacgagggggtt
cagctcgggatcgccgtctcgctcggcgacgacgggctgatcgtgccggtgatccgcgac
gctcaggacctggcgcccgaggggatcgcccaggcgatcaaggagatcgcacgccgggct
cgtgacagacagctcgccccggacgacgtccgcggtgcgagcttcacgatcacgaacccc
ggagcggcgggagcggtgttcgcgacgccgatcatcaacgtgccgcaggtcgcgatcctc
gacctcgaagcgatcgtccggcggcccacgatcgtgaccggcgccgacggcaccgagtcg
atcgcgatccggccgatggcgaacctgatcctcggctgggaccaccgtgcgatcgacggc
atgtacgcggcacggttcctcactgcgctgcgcacgcggctcgaggacccgcacggccgt
cccgattga

DBGET integrated database retrieval system