KEGG   Conexibacter woesei: Cwoe_4442Help
Entry
Cwoe_4442         CDS       T01153                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
cwo  Conexibacter woesei
Pathway
cwo00010  Glycolysis / Gluconeogenesis
cwo00620  Pyruvate metabolism
cwo00640  Propanoate metabolism
cwo00680  Methane metabolism
cwo01100  Metabolic pathways
cwo01110  Biosynthesis of secondary metabolites
cwo01120  Microbial metabolism in diverse environments
cwo01130  Biosynthesis of antibiotics
cwo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cwo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cwoe_4442
   00620 Pyruvate metabolism
    Cwoe_4442
   00640 Propanoate metabolism
    Cwoe_4442
  Energy metabolism
   00680 Methane metabolism
    Cwoe_4442
Enzymes [BR:cwo01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Cwoe_4442
Lipid biosynthesis proteins [BR:cwo01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Cwoe_4442
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ADB52856
UniProt: D3F7W2
Position
complement(4736083..4737660)
Genome map
AA seq 525 aa AA seqDB search
MGRYEVACAAHRWEVPERYNIAQDVCDKHSPEKLAMVWERFDGARRELTWGELQALANQA
AFVLRDAGVGRGDRVAVVLPPTPETAAVFFGVWKLGAILLSMSVLYGDEGIRHRLGDAEP
AVLVTDATNADRFADAGVRVLVLDESGDASLLAGAPTDPISTDTAADDPAQLYYTSGTTG
LAKGIVHAHRYLLAHEEFVYCHEVREGERFHGMGEWAWAAGIAPLLGPWRYGAVQCVYQR
EGGFDPRRQLDFLSRHQVSNLFTTPTAMRSMMAIADAGSQYPCGFRRVCSAGEPLNPEAI
RWFREQYGVTVLDYYGLTESYPLVGNYPWMEVREGSMGRPMPGWDVRILDEDEQPVAVGE
RGEICLRARTNPHYPLGYWRNEEAAAETFGGEWFHTKDAASCDEDGYYWYEGRADDVIIS
AGYRVGPFEVESACLEHPAVAEAAVVASPDERRGTIVKAFVVLADRFAPSDALADEIKAH
VREHLSAYAYPRRIEFVTELPKTLTGKIRRIELRHLEAQRARGEG
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgggccggtatgaggtagcgtgcgcagcgcatcgctgggaggtgcccgagcgctacaac
atcgcgcaggacgtgtgcgacaagcactcgcccgagaagctcgcgatggtgtgggagcgc
ttcgacggggcgcggcgggagctgacgtggggggagctgcaggcgctcgcgaaccaggcg
gcgttcgtgctgcgcgacgccggtgtcgggcgtggggatcgcgtggcggtggtgctgccg
ccgacgccggagaccgcggcagtgttcttcggggtctggaagctcggggcgatcctgctg
tcgatgagcgtgctgtacggcgacgaggggatccgccatcggctgggcgacgcggagccg
gcggtgctggtgaccgacgcgacgaacgcggaccgattcgcggatgccggcgtgcgggtg
ctggtgctcgacgagagcggcgacgcgtcgctgctcgcgggcgcgccgaccgatccgatc
tcgaccgacacggcggcggatgacccggcgcagctctattacacgtccggcacgacgggg
ctggcgaaggggatcgtgcacgcgcatcggtatctgctcgcgcacgaggagttcgtctac
tgccacgaggtgcgggagggcgagcgcttccacgggatgggcgagtgggcgtgggcggcg
gggatcgcgccgctgctgggtccgtggcgttacggcgcggtgcagtgcgtctaccagcgg
gagggcggcttcgaccctcgcagacagctcgatttcctctcgcgccatcaggtgagcaac
ctgttcacgacgccgacggcgatgcggtcgatgatggcgatcgcggatgccggttcgcag
tacccgtgcgggttccggcgcgtctgctctgcgggcgagccgttgaaccctgaggcgatc
cgctggttccgcgagcagtacggcgtcaccgtgctcgactactacggcctgacggagtcg
tatccgctcgtcggcaactatccgtggatggaggtccgcgagggttcgatgggccgcccg
atgcccggctgggatgtgcggatcctcgatgaggacgagcagcccgtcgcagtcggagag
cgcggcgagatctgcctgcgcgcgcgcaccaacccgcactacccgctcggctattggcgc
aacgaggaagcagcggccgagacgttcggcggcgagtggttccacaccaaggacgccgcg
tcctgcgacgaggacggctactactggtacgagggccgcgccgacgacgtgatcatctcc
gccggctaccgcgtcggcccgttcgaggtcgagtccgcatgcctggagcaccccgcggtc
gccgaagccgcggtggtcgcctcacccgacgagcggcgcggaacgatcgtgaaggcgttc
gtcgtcctcgccgaccgcttcgcaccctccgacgcgctcgccgacgagatcaaggcccac
gtgcgcgagcacctctcggcctatgcatacccgcgccgcatcgagttcgtgaccgagctg
ccgaagacgctgaccggcaagatccgccgcatcgagctgcgccacctcgaggcgcagcgc
gcgcggggcgagggctga

DBGET integrated database retrieval system