KEGG   Conexibacter woesei: Cwoe_4528Help
Entry
Cwoe_4528         CDS       T01153                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cwo  Conexibacter woesei
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cwo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cwoe_4528
   01230 Biosynthesis of amino acids
    Cwoe_4528
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cwoe_4528
   00051 Fructose and mannose metabolism
    Cwoe_4528
   00562 Inositol phosphate metabolism
    Cwoe_4528
Enzymes [BR:cwo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Cwoe_4528
Exosome [BR:cwo04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Cwoe_4528
  Exosomal proteins of bladder cancer cells
   Cwoe_4528
  Exosomal proteins of melanoma cells
   Cwoe_4528
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4827412..4828176)
Genome map
AA seq 254 aa AA seqDB search
MTAARTPLIAGNWKMHKTVEEAEAFIQALLPRVATFDSVDVGICPPFTSLQAMVDSARGS
IVRVYAQNMHYADQGAFTGEVSAPMLSELDVHGVILGHSERREYFGETDKALALKVPKAL
EAGLEPILCVGETEEERERGDTERKLRHQIQEDLAKVPEDRLADVVIAYEPIWAIGTGLT
ATPEQAQEACAFVRALVGQRSEDAAQRVRVLYGGSMKADNAAELLALPDVDGGLVGGASL
EAEPFSTIVGAASA
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
ttgactgctgctcggaccccgctgatcgcgggcaactggaagatgcacaagacggtcgaa
gaggcggaggcgttcatccaggcgttgctgccgcgcgtcgcgacgttcgactcggtcgac
gtcggcatctgcccgccgttcacgtcgctgcaggcgatggtcgactccgcgcgcggctcg
atcgtgcgcgtctacgcgcagaacatgcactacgccgaccagggcgcgttcaccggcgag
gtctcggcgccgatgctgagcgagctggacgtccacggcgtgatcctcggtcactcagag
cggcgcgagtacttcggcgagaccgacaaggcgctggcgctgaaggtgccgaaggcgctg
gaggcgggcctggagccgatcctctgcgtcggcgagaccgaggaggagcgcgagcgcggc
gacaccgagcgcaagctccgccaccagatccaggaggatctcgcgaaggtccccgaggac
aggctcgccgacgtcgtgatcgcgtacgagccgatctgggcgatcggcaccggcctgacc
gcgacgcccgagcaggcgcaggaggcgtgcgccttcgtgcgggcgctcgtcggccagcgc
tccgaggacgcggcgcagcgcgtgcgtgtgctctacggcggctcgatgaaggccgacaac
gcggcggagctgctcgcgctgccggacgtcgacggcgggctcgtcggcggcgccagcctc
gaggccgagccgttctcgacgatcgtgggagcggcgtcggcatga

DBGET integrated database retrieval system