KEGG   Conexibacter woesei: Cwoe_4894Help
Entry
Cwoe_4894         CDS       T01153                                 

Definition
(GenBank) NmrA family protein
Organism
cwo  Conexibacter woesei
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
5221979..5222821
Genome map
AA seq 280 aa AA seqDB search
MTVLVTGATGQIGRLVIERLLAAGATVRALSRDPSRAALPTAVEVVAGDLTVPSSLAAAF
DGVDAAHLLAAVGDDYGPNPAAAGIVAQAERAGVRRVTVLWRGEAGPLEHAVAASRLEWT
RLEPAEFMSNALHWAESIRSEGVVREPYADVLGAVVDEADVAAVAAAILLDGGQAGRVLT
PTGPEALTPPQRVAALAAATGREIRYVELTDAQARERWRAFGHTDDLIELLAGYHSAPPP
ESYTVSPIVEQLTGRPPRSFAAWAQEHADVFGRVSRPAAV
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtgctggtgaccggtgcgacggggcagatcggccgcctcgtgatcgagcgcctg
ctcgccgcgggcgcgacggtgcgcgcgctctcgcgcgatccgtcgcgcgccgccctgccg
accgccgtcgaggtcgtcgcgggcgacctgaccgtcccgtcgtcgctggcggcggcgttc
gacggcgtcgacgccgcccacctgctcgcggccgtcggcgacgactacggacccaaccca
gccgccgccgggatcgtcgcgcaggccgagcgggccggggtgcgacgcgtcacggtgctg
tggcgcggcgaggcggggccgctggagcacgcggtcgcggcgagccgcctggagtggacg
cggctggagccggccgagttcatgtcgaacgcgctgcactgggccgagtcgatccgctcc
gagggcgtcgtccgcgagccgtacgccgacgtgctcggcgccgtcgtcgacgaggccgac
gtcgcggccgtcgccgccgcgatcctcctcgacggcggtcaggcgggccgcgtgctgacg
ccgacggggcccgaggcgctgacgcccccgcagcgcgtcgccgcgctcgccgccgccacc
ggtcgcgagatccgctacgtcgagctgaccgacgcgcaggcgcgcgagcgctggcgcgcg
ttcgggcacaccgacgacctgatcgagctgctcgccggctaccacagcgctccgccgccg
gagtcgtacacggtctccccgatcgtcgagcagctgaccggccgcccgccgcgcagcttc
gccgcgtgggcgcaggaacacgccgacgtgttcggccgcgtcagccggcctgcggcggtc
tga

DBGET integrated database retrieval system