KEGG   Conexibacter woesei: Cwoe_4899Help
Entry
Cwoe_4899         CDS       T01153                                 

Definition
(GenBank) Extracellular ligand-binding receptor
  KO
K01999  branched-chain amino acid transport system substrate-binding protein
Organism
cwo  Conexibacter woesei
Pathway
cwo02010  ABC transporters
cwo02024  Quorum sensing
Module
cwo_M00237  Branched-chain amino acid transport system
Brite
KEGG Orthology (KO) [BR:cwo00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Cwoe_4899
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    Cwoe_4899
Transporters [BR:cwo02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Branched-chain amino acid transporter [MD:M00237] [OT]
    Cwoe_4899
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peripla_BP_6 ANF_receptor
Motif
Other DBs
NCBI-ProteinID: ADB53311
UniProt: D3FC16
Position
complement(5226332..5227660)
Genome map
AA seq 442 aa AA seqDB search
MYAGTRARRMLAVGAGAIVLGLAGCGGDDDDGGGGGTATTTGGSAQAPADTSFELTIGDL
VPLTGDLSPFGPPGRKSADLALTQIRDAMGEAGVDTTVSVEHSDTESSPQAAVQAARQLI
SGGAGCLAGPWASSETIAVAESVAARQRTPLVSPSSTDSGITDLDDDGFVYRTAPSDNLQ
ARALADVVEEELGGTDGTISLAARNDAYGQGFIDKFRAAWEEKGGRTTGPVLYDPEQPSY
NSEAGEIVAGNPDAYVIIDFFETYGKMGASLVRTGRFDPTRLFTADGLASDRIPDTIPTR
ALAGARGTRPGTPESGAVVDQFARIYRAAGGAPRQTFDAQNFDATMLCYLAALAAGSSDG
ADIAEQMQAVSSPPGERFTFLELADGIRAIANGDEVDFDGVTGPIDFDDNGDPTAATYEV
YRYGSDGVLRVDRLFEARATER
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgtacgcaggaacgcgcgcccgacgcatgctggccgtcggcgctggtgcgatcgtgctc
ggactcgccggttgcggcggcgacgacgacgacgggggaggcggaggcacggccacgacg
accggtggctccgcccaggcgcccgcggacacgtcgttcgagctgacgatcggcgacctg
gtgccgctgaccggcgacctgtcgccgttcgggccgcccggacgcaagtcggccgacctg
gcgctcacgcagatcagagacgcgatgggcgaggcgggcgtcgacacgaccgtctccgtc
gagcacagcgacaccgagtccagcccgcaggccgccgtgcaggccgcgcgacagctgatc
tcgggcggcgccggctgtctcgccggcccgtgggcgtcgtcggagacgatcgcggtcgcc
gagtcggtcgccgcgcgccagagaacgccgctggtgtcgccgtcgtcgaccgactccggc
atcaccgacctcgacgacgacggcttcgtctaccgcaccgcgccgtcggacaacctgcag
gcgagagcgctcgccgacgtcgtcgaggaggaactcggcggcaccgacggcacgatctcg
ctcgcggcccgcaacgacgcatacggccagggcttcatcgacaagttcagagccgcctgg
gaggagaagggcggcagaacgaccggtcccgtcctgtacgaccctgagcagcccagctac
aactcggaggccggcgagatcgtcgccgggaaccccgacgcgtacgtgatcatcgacttc
ttcgagacgtacgggaagatgggcgcgtcactcgtgcggacgggcagattcgatccgacg
agactgttcaccgcggatggcctcgcgtcggacagaatccccgacacgatcccgacgaga
gcgctcgcgggggcgcgcggcacgcggcccggcacgcccgagtccggggcggtcgtggac
cagttcgcgagaatctacagagcggccggcggcgccccgcggcagacgttcgacgcgcag
aacttcgacgcgacgatgctctgctacctcgccgcgctcgcggccggttcgagcgacggc
gccgacatcgccgagcagatgcaggcggtcagcagccctcccggcgagagattcacgttc
ctggagctggccgacgggatcagagcgatcgcgaacggtgacgaggtcgacttcgacggc
gtcaccggcccgatcgacttcgatgacaacggcgacccgacggccgccacctacgaggtc
tacagatacggctcggacggcgtgctgagagtcgaccggctgttcgaggcgagagcgacc
gagagatag

DBGET integrated database retrieval system