KEGG   Conexibacter woesei: Cwoe_4909Help
Entry
Cwoe_4909         CDS       T01153                                 

Definition
(GenBank) transcriptional regulator, MarR family
Organism
cwo  Conexibacter woesei
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(5236350..5236784)
Genome map
AA seq 144 aa AA seqDB search
MADRHRLYHRVNLTAHRLRVLADQRLLDVVGVTAAQAGVLLIVGDAAEPVRQRDLARLLR
QRESAVTAMVERLIAAGQLERERPPGDGRTWLLRLTAGGETALVVVRRELEAFNARAFRG
VPAAERAVVARALDRVLDNLSDDA
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atggccgacagacaccgcctctaccaccgcgtcaacctgaccgcgcaccggctgcgcgtg
ctcgccgaccagcggctgctcgacgtcgtcggcgtcaccgccgcgcaggccggcgtgctg
ctgatcgtcggcgatgccgccgagccggtccgccaacgcgacctcgcgcggttgctgcgg
cagcgcgagtcggccgtcaccgcgatggtcgagcggctgatcgcggccggccagctggag
cgcgagcgcccgcccggcgacggccgcacgtggctgctgcggctgaccgccggtggcgag
accgcgctcgtggtcgtgcggcgcgagctggaggcgttcaacgcgcgtgccttcagaggc
gtcccggccgccgagcgggccgtcgtcgcgcgggcgctcgaccgcgtgctcgacaacctc
tccgacgacgcctga

DBGET integrated database retrieval system