KEGG   Conexibacter woesei: Cwoe_4911Help
Entry
Cwoe_4911         CDS       T01153                                 

Definition
(GenBank) sulfate ABC transporter, ATPase subunit
  KO
K02045  sulfate transport system ATP-binding protein [EC:3.6.3.25]
Organism
cwo  Conexibacter woesei
Pathway
cwo00920  Sulfur metabolism
cwo02010  ABC transporters
Module
cwo_M00185  Sulfate transport system
Brite
KEGG Orthology (KO) [BR:cwo00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Cwoe_4911
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Cwoe_4911
Enzymes [BR:cwo01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.25  sulfate-transporting ATPase
     Cwoe_4911
Transporters [BR:cwo02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Sulfate transporter [MD:M00185] [OT]
    Cwoe_4911
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 TOBE_3 TOBE TOBE_2 SMC_N AAA_29 AAA_22 AAA_23 SbcCD_C AAA_16 RsgA_GTPase AAA_25 NACHT AAA_33 TniB AAA_15
Motif
Other DBs
NCBI-ProteinID: ADB53323
UniProt: D3FC28
Position
complement(5237675..5238685)
Genome map
AA seq 336 aa AA seqDB search
MIAVEGISKRFGDYTALDDVSIEVPDGSLTALLGPSGSGKSTLLRIIGGLESPDSGRVLI
HGEDATSVPPQRREIGFVFQHYAAFKHMTVRDNVAFGLTIRKQPKVQIAERVDELLRIVG
LAGYAKRYPNQLSGGQRQRMALARALAVEPRVLLLDEPFGALDAKVRAELREWLRRLHDE
VHVTTLLVTHDQEEAMSIADHIAVMDNARIEQFGSPRELYDEPSNPFVMGFLGPVSQLGD
RLVRPHDIALGAQSEDGALEAMVSRVIHLGFEVRVELMLTTGEAVTAQITRTEADELELG
VGDIVWLRSAGSTALRAERAVAPERANDEPLRAAEA
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcagtagaaggaatctccaagcggttcggcgactacaccgcgctcgacgacgtc
tcgatagaggtgccggacggctcgctgaccgcgctgctcggcccgagcggcagcggcaag
tcgacgctgctgcggatcatcggcgggctcgagtcgcccgacagcgggcgcgtgctgatc
cacggcgaggacgccacgagcgtgccgccgcagcggcgcgagatcggcttcgtcttccag
cactacgcggcgttcaagcacatgaccgtgcgcgacaacgtcgcgttcgggctcacgatc
cgcaagcagccgaaggtgcagatcgcggagcgcgtcgacgagctgctgagaatcgtcggt
ctcgccggctacgccaagcgctaccccaaccagctctccggcggccagcgccagcggatg
gcgctcgcccgcgcgctcgcggtcgagccgcgcgtgctgctgctcgacgagccgttcggc
gcgctcgacgcgaaggtccgcgctgagctgcgcgagtggctgcggcggctgcacgacgag
gtccacgtgacgaccctgctggtcacgcacgaccaggaggaggcgatgtcgatcgccgac
cacatcgcggtcatggacaacgccagaatcgagcagttcggcagcccgcgcgagctctac
gacgagccgtcgaacccgttcgtgatgggcttcctcggcccggtcagccagctcggcgac
cggctcgtgcggccgcacgacatcgcgctcggcgcgcagtcggaggacggcgcgctcgag
gcgatggtgagccgcgtgatccacctcggcttcgaggtccgcgtcgagctgatgctgacg
accggcgaggccgtcaccgcgcagatcacgcgcaccgaggcggacgagctggagttgggc
gtcggcgacatcgtctggctgcgttcggccggttcgaccgcgctgcgggccgagcgggcc
gtcgcgcccgagcgggcgaacgacgagccgctgagggcggcggaggcgtag

DBGET integrated database retrieval system