KEGG   Conexibacter woesei: Cwoe_4913Help
Entry
Cwoe_4913         CDS       T01153                                 

Definition
(GenBank) sulfate ABC transporter, inner membrane subunit CysT
  KO
K02046  sulfate transport system permease protein
Organism
cwo  Conexibacter woesei
Pathway
cwo00920  Sulfur metabolism
cwo02010  ABC transporters
Module
cwo_M00185  Sulfate transport system
Brite
KEGG Orthology (KO) [BR:cwo00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Cwoe_4913
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Cwoe_4913
Transporters [BR:cwo02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Sulfate transporter [MD:M00185] [OT]
    Cwoe_4913
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: ADB53325
UniProt: D3FC30
Position
complement(5239481..5240314)
Genome map
AA seq 277 aa AA seqDB search
MSTTAITDRVPSRRRPAWRSSGALAMGVATLWLSIIVLIPLAAVVVRSTDGGFDTFWNAV
TSRQSLAALRFTVLVSLLTAAINAAFGTLIAWVLVRDRFAGKRLVNALIDLPFALPTIVA
GLTLLALYGPRSPIGVDFAYTQGAVLLALLFVTLPFVIRAVQPVLIELDREMEQAALSLG
ANNRTIFRRIVLPNLVPAILSGAGLAFARAVGEFGSIVLISGNIPFDTQVSSVYIFKQIE
SDNPVGAAAVATVLLFVSVLVLVGIRGLGRWGARHDR
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
gtgagcacgaccgcgatcaccgatcgcgtcccctcgcggcgacgcccagcctggcgctcc
tccggagcgctggcgatgggcgtcgccacgttgtggctgtcgatcatcgtcctgattccc
ctcgccgccgtcgtggtccgttcgaccgacggcggcttcgacacgttctggaacgcggtc
acgagcagacagtcgctcgccgcgctgcgcttcaccgtgctcgtgtcgctgctgaccgcg
gcgatcaacgccgccttcggcacgctgatcgcgtgggtgctcgtgcgcgacagattcgcc
ggcaagcggctcgtcaacgcgctgatcgacctcccgttcgcgctgccgacgatcgtcgcc
ggcctcacgctgctcgcgctctacgggccgagaagcccgatcggcgtcgacttcgcctac
acgcagggggcggtcctgctcgcgctcctgttcgtcacgctgccgttcgtgatccgcgcc
gtgcagccggtgctgatcgagctcgacagagagatggagcaggcggcgctgtcgctgggc
gcgaacaaccgcacgatcttccgccgcatcgtgctgccgaacctcgtccccgcgatcctc
agcggcgccggcctggcgttcgcccgcgcggtcggcgagttcggctcgatcgtgctgatc
tcgggcaacatcccgttcgacacgcaggtcagctcggtctacatcttcaagcagatcgag
agcgacaacccggtcggcgcggcggccgtcgcgacggtgctgctgttcgtctccgtgctc
gtcctcgtcggcatccgcggcctcggccgctggggggctcgtcatgaccgttag

DBGET integrated database retrieval system