KEGG   Conexibacter woesei: Cwoe_4919Help
Entry
Cwoe_4919         CDS       T01153                                 

Definition
(GenBank) alpha/beta hydrolase fold protein
Organism
cwo  Conexibacter woesei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_6 Abhydrolase_1 Hydrolase_4 Abhydrolase_4 Thioesterase DUF1057 Lipase_3 Chlorophyllase2
Motif
Other DBs
NCBI-ProteinID: ADB53331
UniProt: D3FC36
Position
5245893..5246747
Genome map
AA seq 284 aa AA seqDB search
MSPFWVTFDDVLPATSETTSTVTVDGLRLRVAHTRPAGIDRPRVVVVLHGWGASIDAVGS
ILAGLRDKVELVALDLPGFGESDMVPAAWSNADYARLVLRLADQLGIERFALVGHSRGAA
ISLVLASDPATSGRIERMVLTGAAGIKPRRRPSYYAKVGMAKAGRVAGAVGGPPGKRVQQ
KIRARAASADWLAAPEALRGTLRNVLAEDLSPRLPQVDAPTLLIWGPDDEDTPLWMAERM
EREIPGAGLVVLRGGGHFAYAERAGEFNVIAAHFLAPPASAPTR
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
gtgagtccgttttgggttacctttgatgacgttttgccggccacctccgagacgacctcc
accgtcaccgtcgacggcctcagactgcgcgtcgcgcacaccagacccgcggggatcgac
cgtccccgcgtcgtcgtcgtgctccacggatggggcgcgagcatcgacgcggtcggttcg
atcctcgccggcctgcgcgacaaggtcgagctggtcgcgctcgacctgcccggcttcggc
gagtccgacatggtccccgccgcctggtccaacgccgactacgcgcggctcgtgctgaga
ctcgccgaccagctcgggatcgagcggttcgcgctcgtcggccactcgcgcggcgccgcg
atctcgctcgtgctcgcgagcgatcccgcgaccagcgggcggatcgagcggatggtcctg
accggcgccgccggcatcaagccgagacgcagaccgtcgtactacgcgaaggtcgggatg
gcgaaggccggccgcgtcgccggcgccgtcggcggtccgcccggcaagcgcgtgcagcag
aagattcgcgcgcgcgccgcgtcggccgactggctcgccgcgccggaggcgctgcgcggc
acgctgcgcaacgtgctcgcggaggacctctccccccgtctgccgcaggtcgacgcgccg
acgctgctgatctggggaccggacgacgaggacacgccgctctggatggccgagcggatg
gagcgcgagatccccggcgccggcctcgtcgtgctcagaggcggcggccacttcgcctac
gccgagcgcgccggcgagttcaacgtgatcgccgcccatttcctcgcgccgcccgcgagc
gcgcccaccagatga

DBGET integrated database retrieval system